Size:100 ul
$289.00
In Stock
SKU
ARP58479_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58479_P050-FITC Conjugated

ARP58479_P050-HRP Conjugated

ARP58479_P050-Biotin Conjugated

HNRPH1 Antibody - middle region (ARP58479_P050)

Rating:
100% of 100
Catalog#: ARP58479_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, IP, WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10042 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HNRPH1 (ARP58479_P050)
Peptide Sequence Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPH1 (ARP58479_P050) antibody is Catalog # AAP58479 (Previous Catalog # AAPP34947)
Datasheets/Manuals Printable datasheet for anti-HNRNPH1 (ARP58479_P050) antibody
Sample Type Confirmation

HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat, MCF7

HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Gene Symbol HNRNPH1
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein H1 (H)
Alias Symbols DKFZp686A15170, HNRPH, hnRNPH, HNRPH1
NCBI Gene Id 3187
Protein Name Heterogeneous nuclear ribonucleoprotein H
Description of Target HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P31943
Protein Accession # NP_005511
Nucleotide Accession # NM_005520
Protein Size (# AA) 449
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPH1.
Protein Interactions HUWE1; UBC; FUS; CEP76; CEP250; VCP; TP53; SUMO2; SUMO3; TUBGCP3; STAU1; MDM2; RPA3; RPA2; RPA1; ERG; ASB2; EED; rev; APBB1; AASDHPPT; IPO11; TNPO3; PEG10; PSMD9; PPP3CA; PPP2CA; PIN1; PARK2; PARP1; FBXO6; TARDBP; YWHAQ; ADRB2; IGSF8; ICAM1; CD81; PAN2; U
  1. What is the species homology for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPH1 Antibody - middle region (ARP58479_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    This target may also be called "DKFZp686A15170, HNRPH, hnRNPH, HNRPH1" in publications.

  5. What is the shipping cost for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HNRNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPH1 Antibody - middle region (ARP58479_P050)
Your Rating
We found other products you might like!