Search Antibody, Protein, and ELISA Kit Solutions

HNRPH1 Antibody - middle region (ARP58479_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58479_P050-FITC Conjugated

ARP58479_P050-HRP Conjugated

ARP58479_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IF, IP, WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
HNRNPH1
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein H1 (H)
NCBI Gene Id:
3187
Protein Name:
Heterogeneous nuclear ribonucleoprotein H
Swissprot Id:
P31943
Protein Accession #:
NP_005511
Nucleotide Accession #:
NM_005520
Alias Symbols:
DKFZp686A15170, HNRPH, hnRNPH, HNRPH1
Replacement Item:
This antibody may replace item sc-10042 from Santa Cruz Biotechnology.
Description of Target:
HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
449
Molecular Weight:
49kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HNRPH1 (ARP58479_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; UBC; FUS; CEP76; CEP250; VCP; TP53; SUMO2; SUMO3; TUBGCP3; STAU1; MDM2; RPA3; RPA2; RPA1; ERG; ASB2; EED; rev; APBB1; AASDHPPT; IPO11; TNPO3; PEG10; PSMD9; PPP3CA; PPP2CA; PIN1; PARK2; PARP1; FBXO6; TARDBP; YWHAQ; ADRB2; IGSF8; ICAM1; CD81; PAN2; U
Blocking Peptide:
For anti-HNRNPH1 (ARP58479_P050) antibody is Catalog # AAP58479 (Previous Catalog # AAPP34947)
Datasheets/Manuals:
Printable datasheet for anti-HNRNPH1 (ARP58479_P050) antibody
Sample Type Confirmation:

HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat, MCF7

HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

275/10/2019 21:37
  • Overall Experience:
  • Quality:
HeLa nuclear extract, pull-down reaction in WB

Submitted by:
Maja Dembic
Syddansk Universitet

HNRPH1

Sample type/lane description: HeLa nuclear extract, RNA pull-down reactions done with RNA oligonucleotides and with HeLa nuclear extract.
Lane 1: 10ug HeLa nuclear extract
Lane 2: 10ug protein; RNA pull-down reaction with sequence harboring GGG triplets known to bind hnRNPF/H.
Lane 3: 10ug protein; RNA pull-down reaction with mutated RNA sequence to reduce binding of hnRNPF/H.

Primary antibody dilution: 1:1000 O.N. at 4°C

Secondary antibody dilution: Anti-rabbit 1:10000.

Protocol: Various samples were run and separated on a Bis-Tris 4-12% gradient gel in MOPS 1x
buffer, under denaturing conditions. The samples were transferred on PVDF membrane
(30V constant; 1h, 30 min) and blotted with the antibodies. After blocking for aspecific binding all primary antibodies were incubated O.N., at 4 degrees. Washing and secondary antibody staining was performed on SNAP i.d. 2.0 Protein Detection System, according to instructions. After incubation with ECL, the membranes were exposed for 5 seconds.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...