Loading...
Catalog No: ARP58479_P050
Price: $0.00
SKU
ARP58479_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HNRNPH1 (ARP58479_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, IP, WB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Concentration0.5 mg/ml
Blocking PeptideFor anti-HNRNPH1 (ARP58479_P050) antibody is Catalog # AAP58479 (Previous Catalog # AAPP34947)
Sample Type Confirmation

HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat, MCF7

HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Description
Gene SymbolHNRNPH1
Gene Full NameHeterogeneous nuclear ribonucleoprotein H1 (H)
Alias SymbolsHNRPH, HNRPH1, hnRNPH
NCBI Gene Id3187
Protein NameHeterogeneous nuclear ribonucleoprotein H
Description of TargetHNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP31943
Protein Accession #NP_005511
Nucleotide Accession #NM_005520
Protein Size (# AA)449
Molecular Weight49 kDa
Protein InteractionsHUWE1; UBC; FUS; CEP76; CEP250; VCP; TP53; SUMO2; SUMO3; TUBGCP3; STAU1; MDM2; RPA3; RPA2; RPA1; ERG; ASB2; EED; rev; APBB1; AASDHPPT; IPO11; TNPO3; PEG10; PSMD9; PPP3CA; PPP2CA; PIN1; PARK2; PARP1; FBXO6; TARDBP; YWHAQ; ADRB2; IGSF8; ICAM1; CD81; PAN2; U
  1. What is the species homology for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPH1 Antibody - middle region (ARP58479_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    This target may also be called "HNRPH, HNRPH1, hnRNPH" in publications.

  5. What is the shipping cost for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPH1 Antibody - middle region (ARP58479_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HNRNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPH1 Antibody - middle region (ARP58479_P050)
Your Rating
We found other products you might like!