Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40238_T100-FITC Conjugated

ARP40238_T100-HRP Conjugated

ARP40238_T100-Biotin Conjugated

HNRPD Antibody - C-terminal region (ARP40238_T100)

Catalog#: ARP40238_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166577 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HNRPD
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-HNRPD (ARP40238_T100)
Peptide Sequence Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPD (ARP40238_T100) antibody is Catalog # AAP40238 (Previous Catalog # AAPP22082)
Datasheets/Manuals Printable datasheet for anti-HNRNPD (ARP40238_T100) antibody
Sample Type Confirmation

HNRNPD is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Dhakras,P.S., Am. J. Physiol. Renal Physiol. 290 (2), F313-F318 (2006)

Kang, X., Chen, W., Kim, R. H., Kang, M. K. & Park, N.-H. Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells. Oncogene 28, 565-74 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19015635

Subramaniam, K., Ooi, L. L. P. J. & Hui, K. M. Transcriptional down-regulation of IGFBP-3 in human hepatocellular carcinoma cells is mediated by the binding of TIA-1 to its AT-rich element in the 3’-untranslated region. Cancer Lett. 297, 259-68 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20599318

Gene Symbol HNRNPD
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Alias Symbols P37, AUF1, AUF1A, HNRPD, hnRNPD0
NCBI Gene Id 3184
Protein Name Heterogeneous nuclear ribonucleoprotein D0
Description of Target HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.
Swissprot Id Q14103
Protein Accession # NP_112738
Nucleotide Accession # NM_031370
Protein Size (# AA) 355
Molecular Weight 39kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPD.
  1. What is the species homology for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPD Antibody - C-terminal region (ARP40238_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    This target may also be called "P37, AUF1, AUF1A, HNRPD, hnRNPD0" in publications.

  5. What is the shipping cost for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPD Antibody - C-terminal region (ARP40238_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HNRNPD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPD Antibody - C-terminal region (ARP40238_T100)
Your Rating