Search Antibody, Protein, and ELISA Kit Solutions

HNRPC Antibody - N-terminal region (ARP41037_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41037_P050-FITC Conjugated

ARP41037_P050-HRP Conjugated

ARP41037_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein C (C1/C2)
NCBI Gene Id:
Protein Name:
Heterogeneous nuclear ribonucleoproteins C1/C2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C1, C2, HNRNP, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC, hnRNPC, HNRPC
Replacement Item:
This antibody may replace item sc-10037 from Santa Cruz Biotechnology.
Description of Target:
HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has one RRM domain that binds to RNAs. Two alternatively spliced transcript variants have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPC.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPC
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-HNRPC (ARP41037_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNRNPC (ARP41037_P050) antibody is Catalog # AAP41037 (Previous Catalog # AAPS02302)
Printable datasheet for anti-HNRNPC (ARP41037_P050) antibody
Sample Type Confirmation:

HNRNPC is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Hayakawa, H. et al. Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress. Biochem. Biophys. Res. Commun. 403, 220-4 (2010). WB, Dog, Human, Mouse, Pig, Rabbit, Rat 21073862

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...