Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41037_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41037_P050-FITC Conjugated

ARP41037_P050-HRP Conjugated

ARP41037_P050-Biotin Conjugated

HNRPC Antibody - N-terminal region (ARP41037_P050)

Catalog#: ARP41037_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10037 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPC
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data Anti-HNRPC (ARP41037_P050)
Peptide Sequence Synthetic peptide located within the following region: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPC (ARP41037_P050) antibody is Catalog # AAP41037 (Previous Catalog # AAPS02302)
Datasheets/Manuals Printable datasheet for anti-HNRNPC (ARP41037_P050) antibody
Sample Type Confirmation

HNRNPC is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Publications

Hayakawa, H. et al. Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress. Biochem. Biophys. Res. Commun. 403, 220-4 (2010). WB, Dog, Human, Mouse, Pig, Rabbit, Rat 21073862

Gene Symbol HNRNPC
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein C (C1/C2)
Alias Symbols C1, C2, HNRNP, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC, hnRNPC, HNRPC
NCBI Gene Id 3183
Protein Name Heterogeneous nuclear ribonucleoproteins C1/C2
Description of Target HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has one RRM domain that binds to RNAs. Two alternatively spliced transcript variants have been described for this gene.
Swissprot Id P07910
Protein Accession # NP_112604
Nucleotide Accession # NM_031314
Protein Size (# AA) 303
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPC.
Protein Interactions SUMO1P1; RALYL; RBM41; ZFYVE26; SUMO1; UBE2I; UBC; SDCBP; LMO2; KPNA4; KPNA3; KPNA2; HNRNPC; EPS8; BRIP1; PALB2; BRCA2; BRCA1; BARD1; CEP250; SUMO2; SUMO3; RAD51; IVNS1ABP; STAU1; MDM2; ERG; EED; RNF2; rev; CDKN2A; PARK2; SRPK2; SRPK1; CLK3; TARDBP; YWHAQ
  1. What is the species homology for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPC Antibody - N-terminal region (ARP41037_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    This target may also be called "C1, C2, HNRNP, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC, hnRNPC, HNRPC" in publications.

  5. What is the shipping cost for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPC Antibody - N-terminal region (ARP41037_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HNRNPC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPC Antibody - N-terminal region (ARP41037_P050)
Your Rating
We found other products you might like!