Size:100 ul
$249.00
In stock
SKU
ARP41195_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41195_T100-FITC Conjugated

ARP41195_T100-HRP Conjugated

ARP41195_T100-Biotin Conjugated

HNRPA3 Antibody - N-terminal region (ARP41195_T100)

Catalog#: ARP41195_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133665 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HNRPA3 (ARP41195_T100)
Peptide Sequence Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPA3 (ARP41195_T100) antibody is Catalog # AAP41195 (Previous Catalog # AAPP22570)
Datasheets/Manuals Printable datasheet for anti-HNRNPA3 (ARP41195_T100) antibody
Sample Type Confirmation

HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Papadopoulou, C., Patrinou-Georgoula, M. & Guialis, A. Extensive association of HuR with hnRNP proteins within immunoselected hnRNP and mRNP complexes. Biochim. Biophys. Acta 1804, 692-703 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 19931428

Süss, C. et al. Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells. Mol. Cell. Proteomics 8, 393-408 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 18854578

Gene Symbol HNRNPA3
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein A3
Alias Symbols FBRNP, HNRPA3, D10S102, 2610510D13Rik
NCBI Gene Id 220988
Protein Name Heterogeneous nuclear ribonucleoprotein A3
Description of Target HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Swissprot Id P51991
Protein Accession # NP_919223
Nucleotide Accession # NM_194247
Protein Size (# AA) 378
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPA3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPA3.
Protein Interactions SUMO2; SUMO3; STAU1; UBC; LIN28A; SUMO1; NEDD8; MDM2; RPA3; RPA2; RPA1; WWOX; ZBTB1; RNF2; EED; rev; PARK2; TARDBP; IGSF8; ICAM1; CD81; PAN2; TP63; WHSC1; VCAM1; ITGA4; IL7R; IFIT3; FN1; ESR1; SMURF1; YWHAE; RPS28; RPS13; RPLP2; RAB1A; PTBP1; HSPA8; HSPA5
Write Your Own Review
You're reviewing:HNRPA3 Antibody - N-terminal region (ARP41195_T100)
Your Rating