Search Antibody, Protein, and ELISA Kit Solutions

HNRPA3 antibody - N-terminal region (ARP41195_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41195_T100-FITC Conjugated

ARP41195_T100-HRP Conjugated

ARP41195_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein A3
Protein Name:
Heterogeneous nuclear ribonucleoprotein A3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FBRNP, HNRPA3, D10S102, 2610510D13Rik
Replacement Item:
This antibody may replace item sc-133665 from Santa Cruz Biotechnology.
Description of Target:
HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPA3.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HNRPA3 (ARP41195_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNRNPA3 (ARP41195_T100) antibody is Catalog # AAP41195 (Previous Catalog # AAPP22570)
Printable datasheet for anti-HNRNPA3 (ARP41195_T100) antibody
Sample Type Confirmation:

HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Süss, C. et al. Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells. Mol. Cell. Proteomics 8, 393-408 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 18854578

Papadopoulou, C., Patrinou-Georgoula, M. & Guialis, A. Extensive association of HuR with hnRNP proteins within immunoselected hnRNP and mRNP complexes. Biochim. Biophys. Acta 1804, 692-703 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 19931428

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...