Size:100 ul
$249.00
In Stock
SKU
ARP40383_T100-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40383_T100 Unconjugated

ARP40383_T100-HRP Conjugated

ARP40383_T100-Biotin Conjugated

HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)

Catalog#: ARP40383_T100-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-10029 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-HNRPA1 (ARP40383_T100)
Peptide SequenceSynthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Concentration0.5 mg/ml
Blocking PeptideFor anti-HNRNPA1 (ARP40383_T100-FITC) antibody is Catalog # AAP40383 (Previous Catalog # AAPP22127)
Datasheets/ManualsPrintable datasheet for anti-HNRNPA1 (ARP40383_T100-FITC) antibody
Sample Type Confirmation

HNRNPA1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceTevosian,S.G., (2005) J. Biol. Chem. 280 (13), 13171-13178
Publications

Li, S. et al. Identification of an aptamer targeting hnRNP A1 by tissue slide-based SELEX. J. Pathol. 218, 327-36 (2009). ICC/IF, Horse, Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine 19291713

Gonen, N. & Assaraf, Y. G. The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1. J. Biol. Chem. 285, 33602-13 (2010). WB, Horse, Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine 20724482

Stark, M., Bram, E. E., Akerman, M., Mandel-Gutfreund, Y. & Assaraf, Y. G. Heterogeneous nuclear ribonucleoprotein H1/H2-dependent unsplicing of thymidine phosphorylase results in anticancer drug resistance. J. Biol. Chem. 286, 3741-54 (2011). WB, ICC/IF, ChIP, Horse, Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine 21068389

Li, S. et al. Aptamer BC15 against heterogeneous nuclear ribonucleoprotein A1 has potential value in diagnosis and therapy of hepatocarcinoma. Nucleic Acid Ther. 22, 391-8 (2012). WB, IHC, Horse, Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine 23062008

Gene SymbolHNRNPA1
Official Gene Full NameHeterogeneous nuclear ribonucleoprotein A1
Alias SymbolsHNRPA1, HNRPA1L3, hnRNP A1, hnRNP-A1
NCBI Gene Id3178
Protein NameHeterogeneous nuclear ribonucleoprotein A1 EMBL AAH71945.1
Description of TargetHNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites.
Swissprot IdQ6IPF2
Protein Accession #NP_002127
Nucleotide Accession #NM_002136
Protein Size (# AA)320
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HNRPA1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HNRPA1.
Protein InteractionsUBC; TP53; PSMD9; TUBGCP3; NEDD1; AURKB; AURKA; STAU1; IVNS1ABP; TNF; PSMB4; MDM2; CHUK; RPA3; RPA2; RPA1; ASB2; ERG; EED; RNF2; rev; IQGAP1; HIST1H2AB; AIMP2; RPL38; RPL27A; QARS; DHX9; CCAR2; ZC3HC1; HNRNPU; PARK2; FBXO6; TARDBP; YWHAQ; SRPK1; XRN1; CSF
  1. What is the species homology for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    This target may also be called "HNRPA1, HNRPA1L3, hnRNP A1, hnRNP-A1" in publications.

  5. What is the shipping cost for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HNRNPA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPA1 Antibody - N-terminal region : FITC (ARP40383_T100-FITC)
Your Rating
Aviva Tips and Tricks
Aviva HIS tag Deal
Aviva Blast Tool
Aviva Live Chat