Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP40383_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40383_T100-FITC Conjugated

ARP40383_T100-HRP Conjugated

ARP40383_T100-Biotin Conjugated

HNRPA1 Antibody - N-terminal region (ARP40383_T100)

Catalog#: ARP40383_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10029 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-HNRPA1 (ARP40383_T100)
Peptide SequenceSynthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HNRNPA1 (ARP40383_T100) antibody is Catalog # AAP40383 (Previous Catalog # AAPP22127)
Datasheets/ManualsPrintable datasheet for anti-HNRNPA1 (ARP40383_T100) antibody
Sample Type Confirmation

HNRNPA1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceTevosian,S.G., (2005) J. Biol. Chem. 280 (13), 13171-13178
Publications

Gonen, N. & Assaraf, Y. G. The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1. J. Biol. Chem. 285, 33602-13 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20724482

Li, S. et al. Aptamer BC15 against heterogeneous nuclear ribonucleoprotein A1 has potential value in diagnosis and therapy of hepatocarcinoma. Nucleic Acid Ther. 22, 391-8 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23062008

Li, S. et al. Identification of an aptamer targeting hnRNP A1 by tissue slide-based SELEX. J. Pathol. 218, 327-36 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19291713

Stark, M., Bram, E. E., Akerman, M., Mandel-Gutfreund, Y. & Assaraf, Y. G. Heterogeneous nuclear ribonucleoprotein H1/H2-dependent unsplicing of thymidine phosphorylase results in anticancer drug resistance. J. Biol. Chem. 286, 3741-54 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21068389

Gene SymbolHNRNPA1
Official Gene Full NameHeterogeneous nuclear ribonucleoprotein A1
Alias SymbolsHNRPA1, HNRPA1L3, hnRNP A1, hnRNP-A1
NCBI Gene Id3178
Protein NameHeterogeneous nuclear ribonucleoprotein A1 EMBL AAH71945.1
Description of TargetHNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites.
Swissprot IdQ6IPF2
Protein Accession #NP_002127
Nucleotide Accession #NM_002136
Protein Size (# AA)320
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HNRPA1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HNRPA1.
Protein InteractionsUBC; TP53; PSMD9; TUBGCP3; NEDD1; AURKB; AURKA; STAU1; IVNS1ABP; TNF; PSMB4; MDM2; CHUK; RPA3; RPA2; RPA1; ASB2; ERG; EED; RNF2; rev; IQGAP1; HIST1H2AB; AIMP2; RPL38; RPL27A; QARS; DHX9; CCAR2; ZC3HC1; HNRNPU; PARK2; FBXO6; TARDBP; YWHAQ; SRPK1; XRN1; CSF
Write Your Own Review
You're reviewing:HNRPA1 Antibody - N-terminal region (ARP40383_T100)
Your Rating
Free Microscope
Aviva Tips and Tricks
Aviva Live Chat
Aviva ChIP Antibodies