SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40566_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP40566_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-HNRNPF (ARP40566_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVM
Concentration0.5 mg/ml
Blocking PeptideFor anti-HNRNPF (ARP40566_P050-FITC) antibody is Catalog # AAP40566
Sample Type Confirmation

HNRNPF is supported by BioGPS gene expression data to be expressed in Jurkat

Gene SymbolHNRNPF
Gene Full NameHeterogeneous nuclear ribonucleoprotein F
Alias SymbolsHNRPF, mcs94-1, OK/SW-cl.23
NCBI Gene Id3185
Protein NameHeterogeneous nuclear ribonucleoprotein F
Description of TargetThis gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Uniprot IDP52597
Protein Accession #NP_004957
Nucleotide Accession #NM_004966
Protein Size (# AA)415
Molecular Weight46kDa
Protein InteractionsHSFY1; C1orf94; CCDC33; EIF4ENIF1; RBFOX2; IKZF3; HNRNPUL1; HNRNPM; FUS; TFG; DZIP3; UBC; AES; NEDD1; CEP250; SUMO2; SUMO3; TP53; CDC20; STAU1; IVNS1ABP; SUMO1; NEDD8; MDM2; WWOX; RPA3; RPA2; RPA1; ERG; EED; rev; PRPF40A; OSGEP; ABCF3; DNAAF5; PPME1; PPP1
  1. What is the species homology for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    This target may also be called "HNRPF, mcs94-1, OK/SW-cl.23" in publications.

  5. What is the shipping cost for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HNRNPF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRNPF Antibody - C-terminal region : FITC (ARP40566_P050-FITC)
Your Rating
We found other products you might like!