Search Antibody, Protein, and ELISA Kit Solutions

HNF4A Antibody - N-terminal region (ARP31946_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31946_P050-FITC Conjugated

ARP31946_P050-HRP Conjugated

ARP31946_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Hepatocyte nuclear factor 4, alpha
NCBI Gene Id:
Protein Name:
Hepatocyte nuclear factor 4-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Replacement Item:
This antibody may replace item sc-101059 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNF4A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNF4A.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-HNF4A (ARP31946_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNF4A (ARP31946_P050) antibody is Catalog # AAP31946
Printable datasheet for anti-HNF4A (ARP31946_P050) antibody

Faure, A. J. et al. Cohesin regulates tissue-specific expression by stabilizing highly occupied cis-regulatory modules. Genome Res. 22, 2163-75 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22780989

Schmidt, D. et al. A CTCF-independent role for cohesin in tissue-specific transcription. Genome Res. 20, 578-88 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20219941

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...