Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31946_P050-FITC Conjugated

ARP31946_P050-HRP Conjugated

ARP31946_P050-Biotin Conjugated

HNF4A Antibody - N-terminal region (ARP31946_P050)

Catalog#: ARP31946_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101059 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data Anti-HNF4A (ARP31946_P050)
Peptide Sequence Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNF4A (ARP31946_P050) antibody is Catalog # AAP31946
Datasheets/Manuals Printable datasheet for anti-HNF4A (ARP31946_P050) antibody

Faure, A. J. et al. Cohesin regulates tissue-specific expression by stabilizing highly occupied cis-regulatory modules. Genome Res. 22, 2163-75 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22780989

Schmidt, D. et al. A CTCF-independent role for cohesin in tissue-specific transcription. Genome Res. 20, 578-88 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20219941

Gene Symbol HNF4A
Official Gene Full Name Hepatocyte nuclear factor 4, alpha
Alias Symbols HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
NCBI Gene Id 3172
Protein Name Hepatocyte nuclear factor 4-alpha
Description of Target The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Swissprot Id P41235
Protein Accession # NP_000448
Nucleotide Accession # NM_000457
Protein Size (# AA) 474
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNF4A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNF4A.
Write Your Own Review
You're reviewing:HNF4A Antibody - N-terminal region (ARP31946_P050)
Your Rating