Search Antibody, Protein, and ELISA Kit Solutions

HNF4A Antibody - C-terminal region (ARP97283_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
hepatocyte nuclear factor 4 alpha
NCBI Gene Id:
Protein Name:
hepatocyte nuclear factor 4-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
TCF, HNF4, MODY, FRTS4, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha
Description of Target:
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Protein Size (# AA):
Molecular Weight:
52 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNF4A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNF4A.
The immunogen is a synthetic peptide directed towards the C terminal region of human HNF4A
Peptide Sequence:
Synthetic peptide located within the following region: PRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HNF4A (ARP97283_P050) antibody is Catalog # AAP97283
Printable datasheet for anti-HIBCH (ARP97283_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...