Search Antibody, Protein, and ELISA Kit Solutions

HNF1A antibody - N-terminal region (ARP51375_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51375_P050-FITC Conjugated

ARP51375_P050-HRP Conjugated

ARP51375_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
HNF1 homeobox A
Protein Name:
Hepatocyte nuclear factor 1-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10791 from Santa Cruz Biotechnology.
Description of Target:
HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNF1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNF1A.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-HNF1A (ARP51375_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNF1A (ARP51375_P050) antibody is Catalog # AAP51375 (Previous Catalog # AAPS24602)
Printable datasheet for anti-HNF1A (ARP51375_P050) antibody
Sample Type Confirmation:

HNF1A is supported by BioGPS gene expression data to be expressed in OVCAR3

Additional Information:
IHC Information: Kidney
IHC Information: Liver
IHC Information: Lung
Target Reference:
Eide,S.A., (er) Diabet. Med. (2008) In press

Scheving, L. A. et al. Epidermal growth factor receptor plays a role in the regulation of liver and plasma lipid levels in adult male mice. Am. J. Physiol. Gastrointest. Liver Physiol. 306, G370-81 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 24407590

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...