- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
HNF1 BETA Antibody - C-terminal region (OABB02080)
Datasheets/Manuals | Printable datasheet for HNF1 BETA Antibody - C-terminal region (OABB02080) |
---|
Tested Species Reactivity | Human, Rat |
---|---|
Predicted Species Reactivity | Hamster|Human|Rat |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Western blot |
Additional Information | Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | Polypeptide |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Rat |
Reference | 1. Bach, I., Mattei, M.-G., Cereghini, S., Yaniv, M. Two members of an HNF1 homeoprotein family are expressed in human liver. Nucleic Acids Res. 19: 3553-3559, 1991. 2. "Entrez Gene: TCF2 transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor". 3. Verdeguer, F., Le Corre, S., Fischer, E., Callens, C., Garbay, S., Doyen, A., Igarashi, P., Terzi, F., Pontoglio, M. A mitotic transcriptional switch in polycystic kidney disease. (Letter) Nature Med. 16: 106-110, 2010. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human;Rat. |
Gene Symbol | HNF1B |
---|---|
Gene Full Name | HNF1 homeobox B |
Alias Symbols | ADTKD3;FJHN;hepatocyte nuclear factor 1-beta;HNF1 beta A;HNF-1B;HNF1beta;HNF-1-beta;HNF2;homeoprotein LFB3;HPC11;LFB3;LF-B3;MODY5;RCAD;T2D;TCF2;TCF-2;Transcription factor 2;transcription factor 2, hepatic;Variant hepatic nuclear factor 1;VHNF1. |
NCBI Gene Id | 6928 |
Protein Name | Hepatocyte nuclear factor 1-beta |
Description of Target | Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. |
Uniprot ID | P35680 |
Molecular Weight | 61324 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Hamster|Human|Rat".
-
How long will it take to receive "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "HNF1 BETA Antibody - C-terminal region (OABB02080)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
This target may also be called "ADTKD3;FJHN;hepatocyte nuclear factor 1-beta;HNF1 beta A;HNF-1B;HNF1beta;HNF-1-beta;HNF2;homeoprotein LFB3;HPC11;LFB3;LF-B3;MODY5;RCAD;T2D;TCF2;TCF-2;Transcription factor 2;transcription factor 2, hepatic;Variant hepatic nuclear factor 1;VHNF1." in publications.
-
What is the shipping cost for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "61324 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HNF1B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HNF1B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HNF1B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HNF1B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HNF1B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HNF1B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.