SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OABB02080
Size:100UG
Price: $432.00
SKU
OABB02080
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for HNF1 BETA Antibody - C-terminal region (OABB02080)
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHamster|Human|Rat
Product FormatLyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ClonalityPolyclonal
ClonePolyclonal
IsotypeRabbit IgG
HostRabbit
ApplicationWestern blot
Additional InformationNotes: Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
::Background: HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
Reconstitution and Storage2°C to 8°C|-20°C
ImmunogenPolypeptide
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT
Concentration500 ug/ml
SpecificityNo cross reactivity with other proteins.
Application InfoWestern blot: 0.1-0.5 ug/ml: Human, Rat
Reference1. Bach, I., Mattei, M.-G., Cereghini, S., Yaniv, M. Two members of an HNF1 homeoprotein family are expressed in human liver. Nucleic Acids Res. 19: 3553-3559, 1991.
2. "Entrez Gene: TCF2 transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor".
3. Verdeguer, F., Le Corre, S., Fischer, E., Callens, C., Garbay, S., Doyen, A., Igarashi, P., Terzi, F., Pontoglio, M. A mitotic transcriptional switch in polycystic kidney disease. (Letter) Nature Med. 16: 106-110, 2010.
Storage BufferEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
DescriptionRabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human;Rat.
Gene SymbolHNF1B
Gene Full NameHNF1 homeobox B
Alias SymbolsADTKD3;FJHN;hepatocyte nuclear factor 1-beta;HNF1 beta A;HNF-1B;HNF1beta;HNF-1-beta;HNF2;homeoprotein LFB3;HPC11;LFB3;LF-B3;MODY5;RCAD;T2D;TCF2;TCF-2;Transcription factor 2;transcription factor 2, hepatic;Variant hepatic nuclear factor 1;VHNF1.
NCBI Gene Id6928
Protein NameHepatocyte nuclear factor 1-beta
Description of TargetTranscription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
Uniprot IDP35680
Molecular Weight61324 MW
  1. What is the species homology for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Hamster|Human|Rat".

  2. How long will it take to receive "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".

  3. What buffer format is "HNF1 BETA Antibody - C-terminal region (OABB02080)" provided in?

    This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    This target may also be called "ADTKD3;FJHN;hepatocyte nuclear factor 1-beta;HNF1 beta A;HNF-1B;HNF1beta;HNF-1-beta;HNF2;homeoprotein LFB3;HPC11;LFB3;LF-B3;MODY5;RCAD;T2D;TCF2;TCF-2;Transcription factor 2;transcription factor 2, hepatic;Variant hepatic nuclear factor 1;VHNF1." in publications.

  5. What is the shipping cost for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61324 MW".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNF1 BETA Antibody - C-terminal region (OABB02080)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HNF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNF1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNF1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNF1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNF1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNF1 BETA Antibody - C-terminal region (OABB02080)
Your Rating