Catalog No: OPCA04741
Price: $0.00
SKU
OPCA04741
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HMGN4 Recombinant Protein (Human) (OPCA04741) (OPCA04741) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Homo sapiens (Human) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK |
Protein Sequence | MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-90 aa |
Tag | N-terminal GST-tagged |
Reference | A quantitative atlas of mitotic phosphorylation. Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) |
Gene Symbol | HMGN4 |
---|---|
Gene Full Name | high mobility group nucleosomal binding domain 4 |
Alias Symbols | high mobility group nucleosome-binding domain-containing protein 4;high mobility group protein N4;high-mobility group (nonhistone chromosomal) protein 17-like 3;high-mobility group protein 17-like 3;HMG17L3;NHC;non-histone chromosomal protein HMG-17-like 3. |
NCBI Gene Id | 10473 |
Protein Name | High mobility group nucleosome-binding domain-containing protein 4 |
Description of Target | Non-histone chromosomal protein HMG-17-like 3 |
Uniprot ID | O00479 |
Protein Accession # | NP_006344 |
Nucleotide Accession # | NM_006353 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 36.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review