HMGN4 Recombinant Protein (Human) (OPCA04741)

Catalog No: OPCA04741

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
• Protein Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-90 aa
• Tag: N-terminal GST-tagged
• Reference: A quantitative atlas of mitotic phosphorylation. Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)

Target Info

• Gene Symbol: HMGN4
• Gene Full Name: high mobility group nucleosomal binding domain 4
• Alias Symbols: high mobility group nucleosome-binding domain-containing protein 4;high mobility group protein N4;high-mobility group (nonhistone chromosomal) protein 17-like 3;high-mobility group protein 17-like 3;HMG17L3;NHC;non-histone chromosomal protein HMG-17-like 3.
• NCBI Gene Id: 10473
• Protein Name: High mobility group nucleosome-binding domain-containing protein 4
• Description of Target: Non-histone chromosomal protein HMG-17-like 3
• Uniprot ID: O00479
• Protein Accession #: NP_006344
• Nucleotide Accession #: NM_006353
• Protein Size (# AA): Recombinant
• Molecular Weight: 36.5 kDa