SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58157_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58157_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-HMGB2 (ARP58157_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HMGB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 87%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
Peptide SequenceSynthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS
Concentration0.5 mg/ml
Blocking PeptideFor anti-HMGB2 (ARP58157_P050-FITC) antibody is Catalog # AAP58157 (Previous Catalog # AAPP32590)
Sample Type Confirmation

HMGB2 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceMcCauley,M.J., (2007) J. Mol. Biol. 374 (4), 993-1004
Gene SymbolHMGB2
Gene Full NameHigh mobility group box 2
Alias SymbolsHMG2
NCBI Gene Id3148
Protein NameHigh mobility group protein B2
Description of TargetHMGB2 is a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. HMGB2 was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP26583
Protein Accession #NP_002120
Nucleotide Accession #NM_002129
Protein Size (# AA)209
Molecular Weight24kDa
Protein InteractionsPKNOX1; UBC; EED; YWHAG; PGD; LDHB; CKB; HMGA1; GZMK; GZMA; CSNK1A1; FN1; SCAF8; APP; TFAP4; CDK2; BKRF1; Cebpb; ELAVL1; HMGB1; CHAF1A; CREBBP; SET; PGR; POU3F1; PRKDC; TP53; RAG1; POU5F1; POU2F2; POU2F1; APEX1; AR; NR3C1;
  1. What is the species homology for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    This target may also be called "HMG2" in publications.

  5. What is the shipping cost for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HMGB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HMGB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HMGB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HMGB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HMGB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HMGB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HMGB2 Antibody - middle region : FITC (ARP58157_P050-FITC)
Your Rating
We found other products you might like!