HMGB1 Protein (OPPA01571)

Catalog No: OPPA01571 (Formerly GWB-37D275)

Size:10UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Lyophilized from a 0.2 um filtered concentrated solution in PBS (pH 7.4)
• Host: E. Coli
• Reconstitution and Storage: It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-omega-cm H₂O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions.
  Lyophilized HMGB1, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze/thaw cycles.
• Purification: The HMGB-1 is purified by proprietary chromatographic techniques.
• Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH.
• Tag: 6xHis tag

Target Info

• Gene Symbol: HMGB1
• Alias Symbols: HMG1, HMG3, HMG-1, SBP-1
• NCBI Gene Id: 3146
• Protein Name: High mobility group protein B1
• Description of Target: HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids.
• Uniprot ID: P09429
• Protein Accession #: NP_002119.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 26 kDa