Catalog No: OPPA01571 (Formerly GWB-37D275)
Size:10UG
Price: $75.00
SKU
OPPA01571
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPPA01571 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized from a 0.2 um filtered concentrated solution in PBS (pH 7.4) |
Host | E. Coli |
Reconstitution and Storage | It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-omega-cm H2O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions. Lyophilized HMGB1, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze/thaw cycles. |
Purification | The HMGB-1 is purified by proprietary chromatographic techniques. |
Purity | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Peptide Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH. |
Tag | 6xHis tag |
Gene Symbol | HMGB1 |
---|---|
Alias Symbols | HMG1, HMG3, HMG-1, SBP-1 |
NCBI Gene Id | 3146 |
Protein Name | High mobility group protein B1 |
Description of Target | HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids. |
Uniprot ID | P09429 |
Protein Accession # | NP_002119.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 26 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!