Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP59013_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59013_P050-FITC Conjugated

ARP59013_P050-HRP Conjugated

ARP59013_P050-Biotin Conjugated

HMGB1 Antibody - N-terminal region (ARP59013_P050)

Catalog#: ARP59013_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12523 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-HMGB1 (ARP59013_P050)
Peptide Sequence Synthetic peptide located within the following region: QTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HMGB1 (ARP59013_P050) antibody is Catalog # AAP59013 (Previous Catalog # AAPP44975)
Datasheets/Manuals Printable datasheet for anti-HMGB1 (ARP59013_P050) antibody
Sample Type Confirmation

HMGB1 is supported by BioGPS gene expression data to be expressed in HEK293T

Gene Symbol HMGB1
Official Gene Full Name High mobility group box 1
Alias Symbols DKFZp686A04236, HMG1, HMG3, SBP-1
NCBI Gene Id 3146
Protein Name High mobility group protein B1
Description of Target Extracellular HMGB1 is an activator of human tumor cell migration operating in concert with EGF. HMGB1 encodes a protein that is potentially involved in the regulation of lipogenic and cholesterogenic gene transcription.
Swissprot Id P09429
Protein Accession # NP_002119
Nucleotide Accession # NM_002128
Protein Size (# AA) 215
Molecular Weight 25kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HMGB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HMGB1.
Protein Interactions AGTRAP; HUWE1; UBC; ASB2; ASB1; ZNF24; MAPK1; HMGA1; ITGA4; FN1; HNF1A; SSRP1; SMARCE1; PSEN1; XPC; XPA; RAD23B; CDK2; TFAP4; TERF2IP; TERF2; HHV8GK18_gp81; SUMO2; FCP1; DNM2; HSPA8; HMGB2; PDIA3; Ccdc15; POU5F1; H3F3A; CREBBP; CDK1; TBP; LRIF1; RASSF4; N
Write Your Own Review
You're reviewing:HMGB1 Antibody - N-terminal region (ARP59013_P050)
Your Rating