SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100839_T100
Price: $0.00
SKU
P100839_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HLX (P100839_T100) antibody
Product Info
Tested Species ReactivityHuman, Frog
Predicted Species ReactivityZebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HLX1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceZebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
Concentration1.0 mg/ml
Blocking PeptideFor anti-HLX (P100839_T100) antibody is Catalog # AAP31195 (Previous Catalog # AAPP01938)
Other Applications Image 1 DataSample Type: Xenopus Laevis embryo stage 46 gut tissue
Primary Dilution: 1:200
ReferenceKennedy, M.A., et al., (1994) Genomics 22 (2), 348-355.
Publications

Homeobox gene HLX is a regulator of HGF/c-met-mediated migration of human trophoblast-derived cell lines. Biol Reprod. 83, 676-83 (2010). 20554918

The H2.0-like homeobox transcription factor modulates yolk sac vascular remodeling in mouse embryos. Arterioscler Thromb Vasc Biol. 34, 1468-76 (2014). 24764455

Description
Gene SymbolHLX
Gene Full NameH2.0-like homeobox
Alias SymbolsHB24, HLX1
NCBI Gene Id3142
Protein NameH2.0-like homeobox protein
Description of TargetH2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
Uniprot IDQ14774
Protein Accession #NP_068777
Nucleotide Accession #NM_021958
Protein Size (# AA)488
Molecular Weight51kDa
Protein InteractionsUBC;
  1. What is the species homology for "HLX1 Antibody - middle region (P100839_T100)"?

    The tested species reactivity for this item is "Human, Frog". This antibody is predicted to have homology to "Zebrafish".

  2. How long will it take to receive "HLX1 Antibody - middle region (P100839_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HLX1 Antibody - middle region (P100839_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HLX1 Antibody - middle region (P100839_T100)"?

    This target may also be called "HB24, HLX1" in publications.

  5. What is the shipping cost for "HLX1 Antibody - middle region (P100839_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HLX1 Antibody - middle region (P100839_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HLX1 Antibody - middle region (P100839_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HLX1 Antibody - middle region (P100839_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HLX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HLX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HLX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HLX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HLX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HLX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HLX1 Antibody - middle region (P100839_T100)
Your Rating