Search Antibody, Protein, and ELISA Kit Solutions

HLA-F Antibody - N-terminal region (ARP49411_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49411_P050-FITC Conjugated

ARP49411_P050-HRP Conjugated

ARP49411_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Major histocompatibility complex, class I, F
NCBI Gene Id:
Protein Name:
HLA class I histocompatibility antigen, alpha chain F
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-105528 from Santa Cruz Biotechnology.
Description of Target:
HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HLA-F.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HLA-F.
The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
Predicted Species Reactivity:
Cow, Human, Pig
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Human: 100%; Pig: 100%
Complete computational species homology data:
Anti-HLA-F (ARP49411_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HLA-F (ARP49411_P050) antibody is Catalog # AAP49411 (Previous Catalog # AAPP29130)
Printable datasheet for anti-HLA-F (ARP49411_P050) antibody
Sample Type Confirmation:

HLA-F is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Burfoot,R.K., (2008) Tissue Antigens 71 (1), 42-50

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...