SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62847_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HLA-E (ARP62847_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Pig: 92%
Peptide SequenceSynthetic peptide located within the following region: IPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQG
Concentration0.5 mg/ml
Blocking PeptideFor anti-HLA-E (ARP62847_P050) antibody is Catalog # AAP62847
Gene SymbolHLA-E
Gene Full NameMajor histocompatibility complex, class I, E
Alias SymbolsQA1, HLA-6.2
NCBI Gene Id3133
Protein NameHLA class I histocompatibility antigen, alpha chain E
Description of TargetHLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail.
Uniprot IDP13747
Protein Accession #NP_005507
Nucleotide Accession #NM_005516
Protein Size (# AA)358
Molecular Weight38kDa
Protein InteractionsUBC; CALR; TAP2; UBD; PPP1R16A; KLRD1; KLRC2; CD8A; KLRC1; HLA-E; B2M;
  1. What is the species homology for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Pig".

  2. How long will it take to receive "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HLA-E Antibody - C-terminal region (ARP62847_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    This target may also be called "QA1, HLA-6.2" in publications.

  5. What is the shipping cost for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HLA-E Antibody - C-terminal region (ARP62847_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HLA-E"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HLA-E"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HLA-E"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HLA-E"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HLA-E"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HLA-E"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HLA-E Antibody - C-terminal region (ARP62847_P050)
Your Rating
We found other products you might like!