SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63521_P050
Price: $0.00
SKU
ARP63521_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HLA-DRB3 (ARP63521_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 100%
Peptide SequenceSynthetic peptide located within the following region: GFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEV
Concentration0.5 mg/ml
Blocking PeptideFor anti-HLA-DRB3 (ARP63521_P050) antibody is Catalog # AAP63521
Gene SymbolHLA-DRB3
Gene Full NameMajor histocompatibility complex, class II, DR beta 3
Alias SymbolsDRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
NCBI Gene Id3125
Protein NameHLA class II histocompatibility antigen, DR beta 4 chain
Description of TargetHLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.
Uniprot IDP13762
Protein Accession #NP_072049
Nucleotide Accession #NM_022555
Protein Size (# AA)266
Molecular Weight27kDa
Protein InteractionsCDCA8; MAP3K13; YWHAE; PKM; HSP90AB1; HSP90AA1; HSPA8; MS4A1; ATP1B1; ANXA11; CTAG1B; POMC;
  1. What is the species homology for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    This target may also be called "DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*" in publications.

  5. What is the shipping cost for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HLA-DRB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HLA-DRB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HLA-DRB3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HLA-DRB3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HLA-DRB3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HLA-DRB3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HLA-DRB3 Antibody - C-terminal region (ARP63521_P050)
Your Rating
We found other products you might like!