Search Antibody, Protein, and ELISA Kit Solutions

HLA-DQA1 Antibody - middle region (ARP80700_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
HLA-DQA1
Official Gene Full Name:
major histocompatibility complex, class II, DQ alpha 1
NCBI Gene Id:
3117
Protein Name:
HLA class II histocompatibility antigen, DQ alpha 1 chain
Swissprot Id:
P01909
Protein Accession #:
NP_002113.2
Nucleotide Accession #:
NM_002122.3
Alias Symbols:
CD, GSE, DQ-A1, CELIAC1, HLA-DQA
Description of Target:
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation
Protein Size (# AA):
254
Molecular Weight:
27 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HLA-DQA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HLA-DQA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HLA-DQA1 (ARP80700_P050) antibody is Catalog # AAP80700
Datasheets/Manuals:
Printable datasheet for anti-HLA-DQA1 (ARP80700_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...