HLA-DQA1 Antibody - middle region (ARP80700_P050)

Catalog No: ARP80700_P050

Host: Rabbit
Target Name: HLA-DQA1
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HLA-DQA1 (ARP80700_P050) antibody is Catalog # AAP80700

Target Info

• Gene Symbol: HLA-DQA1
• Gene Full Name: major histocompatibility complex, class II, DQ alpha 1
• Alias Symbols: DQA1, DQ-A1, CELIAC1, HLA-DQA
• NCBI Gene Id: 3117
• Protein Name: HLA class II histocompatibility antigen, DQ alpha 1 chain
• Description of Target: HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation
• Uniprot ID: P01909
• Protein Accession #: NP_002113.2
• Nucleotide Accession #: NM_002122.3
• Protein Size (# AA): 254
• Molecular Weight: 27 kDa