Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP80700_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

HLA-DQA1 Antibody - middle region (ARP80700_P050)

Catalog#: ARP80700_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HLA-DQA1 (ARP80700_P050) antibody is Catalog # AAP80700
Datasheets/ManualsPrintable datasheet for anti-HLA-DQA1 (ARP80700_P050) antibody
Gene SymbolHLA-DQA1
Official Gene Full Namemajor histocompatibility complex, class II, DQ alpha 1
Alias SymbolsCD, GSE, DQ-A1, CELIAC1, HLA-DQA
NCBI Gene Id3117
Protein NameHLA class II histocompatibility antigen, DQ alpha 1 chain
Description of TargetHLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation
Swissprot IdP01909
Protein Accession #NP_002113.2
Nucleotide Accession #NM_002122.3
Protein Size (# AA)254
Molecular Weight27 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HLA-DQA1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HLA-DQA1.
Write Your Own Review
You're reviewing:HLA-DQA1 Antibody - middle region (ARP80700_P050)
Your Rating
Aviva Tissue Tool
Aviva HIS tag Deal
Aviva Tips and Tricks
Aviva Travel Grant