Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP54303_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP54303_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-HK2 (ARP54303_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Additional InformationIHC Information: 721_B cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 6-18%.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Concentration0.5 mg/ml
Blocking PeptideFor anti-HK2 (ARP54303_P050-FITC) antibody is Catalog # AAP54303 (Previous Catalog # AAPP31052)
Sample Type Confirmation

HK2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

ReferencePaudyal,B., (2008) Cancer Sci. 99 (2), 260-266
Gene SymbolHK2
Gene Full NameHexokinase 2
Alias SymbolsHKII, HXK2
NCBI Gene Id3099
Protein NameHexokinase-2
Description of TargetHexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-348 AI278414.1 4-351 349-732 CB160837.1 11-394 c 733-1006 BM912287.1 1-274 c 1007-1333 AI085541.1 1-327 c 1334-1477 AW134604.1 8-151 1478-4058 AF148513.1 1-2581 4059-5498 BC064369.1 2575-4014 5499-5615 BM706373.1 303-419 5616-7109 BC064369.1 4130-5623
Uniprot IDP52789
Protein Accession #NP_000180
Nucleotide Accession #NM_000189
Protein Size (# AA)917
Molecular Weight102kDa
Protein InteractionsUBQLN1; MAGEA12; SUMO2; SUMO3; UBC; EGFR; rev; H2AFV; WDR61; ARIH2; PDLIM1; PYGL; NUBP1; IPO5; HEXB; FNTA; FBXO6; PARK2; UBD; ITGA4; NUDCD3; UBQLN4; SLC2A4; ELAVL1; PTGDS; ZBTB17; PRKCE; IGFBP4;
  1. What is the species homology for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    This target may also be called "HKII, HXK2" in publications.

  5. What is the shipping cost for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "102kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HK2 Antibody - N-terminal region : FITC (ARP54303_P050-FITC)
Your Rating
We found other products you might like!