HIV-2 gp-36 Protein (OPPA00998)

Catalog No: OPPA00998 (Formerly GWB-359CA2)

Size:100UG

Product Info

• Predicted Species Reactivity: Human Immunodeficiency Virus Type 2
• Product Format: Liquid 0.01M Na₂CO₃, 0.01M Na₃EDTA, 0.014M beta-mercaptoethanol, 0.05% Tween-20
• Host: E. Coli
• Application: ELISA, WB
• Reconstitution and Storage: HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
• Concentration: 1 mg/ml
• Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
• Specificity: Reactive with human HIV positive serum.
• Protein Sequence: EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNS WDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC.
• Application Info: HIV-2 gp-36 antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.

Target Info

• Gene Symbol: HIV-2 gp36 (390-702)
• Alias Symbols: HIV-2 gp-36 (390-702 a.a.), HIV-2 gp36 (390-702 a.a.) Recombinant
• Description of Target: HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.
• Protein Size (# AA): Recombinant
• Molecular Weight: 34 kDa