Histone H4 Antibody (OAAF08201)

Catalog No: OAAF08201 (Formerly GWB-ASF156)

Size:100 ug

Click here to learn more about Aviva's By-Request Conjugation Service.

Western blot analysis of lysates from K562/A549, using Histone H4 Antibody. The lane on the right is blocked with the synthesized peptide.

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma tissue, using Histone H4 Antibody. The picture on the right is blocked with the synthesized peptide.

Immunofluorescence analysis of HeLa cells, using Histone H4 Antibody. The picture on the right is blocked with the synthesized peptide.

Product Info

• Predicted Species Reactivity: Human|Monkey|Mouse|Rat
• Product Format: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Clonality: Polyclonal
• Isotype: IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human Histone H4.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
• Peptide Sequence: Synthetic peptide located within the following region: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
• Concentration: 1mg/ml
• Specificity: Histone H4 Antibody detects endogenous levels of total Histone H4 protein.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:1000

Target Info

• Gene Symbol: H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9
• Gene Full Name: H4 clustered histone 1|H4 clustered histone 11|H4 clustered histone 12|H4 clustered histone 13|H4 clustered histone 14|H4 clustered histone 15|H4 clustered histone 2
• Alias Symbols: dJ160A22.1;dJ160A22.2;dJ221C16.1;dJ221C16.9;FO108;H4;H4 histone family, member A;H4 histone family, member B;H4 histone family, member C;H4 histone family, member D;H4 histone family, member E;H4 histone family, member G;H4 histone family, member H;H4 histone family, member I;H4 histone family, member J;H4 histone family, member K;H4 histone family, member M;H4 histone family, member N;H4 histone, family 2;H4.k;H4/b;H4/c;H4/d;H4/e;H4/g;H4/h;H4/I;H4/j;H4/k;H4/m;H4/n;H4/o;H4/p;H4-16;H4C1;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4F2;H4F2iii;H4F2iv;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4M;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4;histone 1, H4a;histone 1, H4b;histone 1, H4c;histone 1, H4d;histone 1, H4e;histone 1, H4f;histone 1, H4h;histone 1, H4i;histone 1, H4j;histone 1, H4k;histone 1, H4l;histone 2, H4a;histone 2, H4b;Histone 4 family, member M;histone 4, H4;histone cluster 1 H4 family member a;histone cluster 1 H4 family member b;histone cluster 1 H4 family member c;histone cluster 1 H4 family member d;histone cluster 1 H4 family member e;histone cluster 1 H4 family member f;histone cluster 1 H4 family member h;histone cluster 1 H4 family member i;histone cluster 1 H4 family member j;histone cluster 1 H4 family member k;histone cluster 1 H4 family member l;histone cluster 1, H4a;histone cluster 1, H4b;histone cluster 1, H4c;histone cluster 1, H4d;histone cluster 1, H4e;histone cluster 1, H4f;histone cluster 1, H4h;histone cluster 1, H4i;histone cluster 1, H4j;histone cluster 1, H4k;histone cluster 1, H4l;histone cluster 2 H4 family member a;histone cluster 2 H4 family member b;histone cluster 2, H4a;histone cluster 2, H4b;histone cluster 4 H4;histone family member;histone H4;histone IV, family 2.
• NCBI Gene Id: 121504|554313|8294|8359|8360|8361|8362|8363|8364|8365|8366|8367|8368|8370
• Protein Name: Histone H4
• Description of Target: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Uniprot ID: P62805
• Molecular Weight: 11 kDa