SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF08184 (Formerly GWB-ASF140)
Size:100 ug
Price: $344.00
SKU
OAAF08184
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:K16 Mouse:K16 Rat:K16
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Histone H4 around the acetylated site of Lys16.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.
Peptide SequenceSynthetic peptide located within the following region: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
Concentration1 mg/ml
SpecificityHistone H4 (Acetyl-Lys16) Antibody detects endogenous levels of total Histone H4 protein only when acetylated at Lys16.
Application InfoIHC: 1:50~100
IF: 1:100~500
ELISA: 1:5000
Gene SymbolH4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1
Gene Full NameH4 clustered histone 1|H4 clustered histone 11|H4 clustered histone 12|H4 clustered histone 13|H4 clustered histone 14|H4 clustered histone 15|H4 clustered histone 3
Alias SymbolsdJ160A22.1;dJ160A22.2;dJ221C16.1;dJ221C16.9;FO108;G13P1;H4;H4 histone family, member A;H4 histone family, member B;H4 histone family, member C;H4 histone family, member D;H4 histone family, member E;H4 histone family, member G;H4 histone family, member H;H4 histone family, member I;H4 histone family, member J;H4 histone family, member K;H4 histone family, member M;H4 histone family, member N;H4 histone, family 2;H4.k;H4/b;H4/c;H4/d;H4/e;H4/g;H4/h;H4/I;H4/j;H4/k;H4/m;H4/n;H4/o;H4/p;H4-16;H4C1;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4F2;H4F2iii;H4F2iv;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4M;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4;histone 1, H4a;histone 1, H4b;histone 1, H4c;histone 1, H4d;histone 1, H4e;histone 1, H4f;histone 1, H4h;histone 1, H4i;histone 1, H4j;histone 1, H4k;histone 1, H4l;histone 2, H4a;histone 2, H4b;Histone 4 family, member M;histone 4, H4;histone cluster 1 H4 family member a;histone cluster 1 H4 family member b;histone cluster 1 H4 family member c;histone cluster 1 H4 family member d;histone cluster 1 H4 family member e;histone cluster 1 H4 family member f;histone cluster 1 H4 family member h;histone cluster 1 H4 family member i;histone cluster 1 H4 family member j;histone cluster 1 H4 family member k;histone cluster 1 H4 family member l;histone cluster 1, H4a;histone cluster 1, H4b;histone cluster 1, H4c;histone cluster 1, H4d;histone cluster 1, H4e;histone cluster 1, H4f;histone cluster 1, H4h;histone cluster 1, H4i;histone cluster 1, H4j;histone cluster 1, H4k;histone cluster 1, H4l;histone cluster 2 H4 family member a;histone cluster 2 H4 family member b;histone cluster 2, H4a;histone cluster 2, H4b;histone cluster 4 H4;histone family member;histone H4;histone IV, family 2;IFI56P;IFIT1P;II56P;interferon-induced protein 56 pseudogene;interferon-induced protein with tetratricopeptide repeats 1, pseudogene.
NCBI Gene Id121504|554313|8294|8359|8360|8361|8362|8363|8364|8365|8366|8367|8368|8370|8373
Protein NameHistone H4
Description of TargetCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Uniprot IDP62805
Molecular Weight11 kDa
  1. What is the species homology for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)" provided in?

    This item is provided in "Liquid PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    This target may also be called "dJ160A22.1;dJ160A22.2;dJ221C16.1;dJ221C16.9;FO108;G13P1;H4;H4 histone family, member A;H4 histone family, member B;H4 histone family, member C;H4 histone family, member D;H4 histone family, member E;H4 histone family, member G;H4 histone family, member H;H4 histone family, member I;H4 histone family, member J;H4 histone family, member K;H4 histone family, member M;H4 histone family, member N;H4 histone, family 2;H4.k;H4/b;H4/c;H4/d;H4/e;H4/g;H4/h;H4/I;H4/j;H4/k;H4/m;H4/n;H4/o;H4/p;H4-16;H4C1;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4F2;H4F2iii;H4F2iv;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4M;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4;histone 1, H4a;histone 1, H4b;histone 1, H4c;histone 1, H4d;histone 1, H4e;histone 1, H4f;histone 1, H4h;histone 1, H4i;histone 1, H4j;histone 1, H4k;histone 1, H4l;histone 2, H4a;histone 2, H4b;Histone 4 family, member M;histone 4, H4;histone cluster 1 H4 family member a;histone cluster 1 H4 family member b;histone cluster 1 H4 family member c;histone cluster 1 H4 family member d;histone cluster 1 H4 family member e;histone cluster 1 H4 family member f;histone cluster 1 H4 family member h;histone cluster 1 H4 family member i;histone cluster 1 H4 family member j;histone cluster 1 H4 family member k;histone cluster 1 H4 family member l;histone cluster 1, H4a;histone cluster 1, H4b;histone cluster 1, H4c;histone cluster 1, H4d;histone cluster 1, H4e;histone cluster 1, H4f;histone cluster 1, H4h;histone cluster 1, H4i;histone cluster 1, H4j;histone cluster 1, H4k;histone cluster 1, H4l;histone cluster 2 H4 family member a;histone cluster 2 H4 family member b;histone cluster 2, H4a;histone cluster 2, H4b;histone cluster 4 H4;histone family member;histone H4;histone IV, family 2;IFI56P;IFIT1P;II56P;interferon-induced protein 56 pseudogene;interferon-induced protein with tetratricopeptide repeats 1, pseudogene." in publications.

  5. What is the shipping cost for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|IFIT1P1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Histone H4 Antibody (Acetyl-Lys16) (OAAF08184)
Your Rating
We found other products you might like!