Histone H2B Recombinant Protein (Muscovy duck) (OPCA02103)

Catalog No: OPCA02103

Histone H2B Recombinant Protein (Crocodylus niloticus) (OPCA02103) in SDS-PAGE showing the molecular weight of approximately 14.2 kDa.

Product Info

• Predicted Species Reactivity: Cairina moschata
• Product Format: Liquid or Lyophilized powder
• Host: Crocodylus niloticus
• Additional Information: Relevance: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
• Protein Sequence: PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-93 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Conserved organization of an avian histone gene cluster with inverted duplications of H3 and H4 genes.Toenjes R., Munk K., Doenecke D.J. Mol. Evol. 28:200-211(1989)
• Alias Symbols: Histone H2B
• Protein Name: Histone H2B
• Description of Target: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Uniprot ID: P14001
• Protein Size (# AA): Recombinant
• Molecular Weight: 14.3 kDa