Catalog No: OAAF08173 (Formerly GWB-ASF128)
Size:100 ug
Price: $344.00
SKU
OAAF08173
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:K5 Mouse:K5 Rat:K5
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Histone H2A around the acetylated site of Lys5.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.
Peptide SequenceSynthetic peptide located within the following region: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGAT
Concentration1mg/ml
SpecificityHistone H2A (Acetyl-Lys5) Antibody detects endogenous levels of total Histone H2A protein only when acetylated at Lys5.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:1000
Gene SymbolH2AZ1
Gene Full NameH2A.Z variant histone 1
Alias SymbolsH2A histone family member Z;H2A.z;H2A.Z-1;H2A/z;H2AFZ;H2AZ;H2AZ histone;histone H2A.Z.
NCBI Gene Id3015
Protein NameHistone H2A.Z
Description of TargetVariant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division.
Uniprot IDP0C0S5
Molecular Weight13 kDa
  1. What is the species homology for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    This target may also be called "H2A histone family member Z;H2A.z;H2A.Z-1;H2A/z;H2AFZ;H2AZ;H2AZ histone;histone H2A.Z." in publications.

  5. What is the shipping cost for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "H2AZ1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "H2AZ1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "H2AZ1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "H2AZ1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "H2AZ1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "H2AZ1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Histone H2A Antibody (Acetyl-Lys5) (OAAF08173)
Your Rating
We found other products you might like!