Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HIST2H2BF Antibody - N-terminal region : FITC (ARP56220_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56220_P050 Unconjugated

ARP56220_P050-HRP Conjugated

ARP56220_P050-Biotin Conjugated

Gene Symbol:
HIST2H2BF
Official Gene Full Name:
Histone cluster 2, H2bf
NCBI Gene Id:
440689
Protein Name:
Histone H2B type 2-F
Swissprot Id:
Q5QNW6
Protein Accession #:
NP_001019770
Nucleotide Accession #:
NM_001024599
Alias Symbols:
MGC131639
Replacement Item:
This antibody may replace item sc-105511 from Santa Cruz Biotechnology.
Description of Target:
HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Protein Size (# AA):
126
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
CHIP, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIST2H2BF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIST2H2BF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HIST2H2BF (ARP56220_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SPRTN; UBC; rev; IGSF8; ICAM1; CD81; ITGA4;
Blocking Peptide:
For anti-HIST2H2BF (ARP56220_P050-FITC) antibody is Catalog # AAP56220 (Previous Catalog # AAPP38138)
Datasheets/Manuals:
Printable datasheet for anti-HIST2H2BF (ARP56220_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...