Search Antibody, Protein, and ELISA Kit Solutions

HIST2H2BF Antibody - N-terminal region (ARP56220_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56220_P050-FITC Conjugated

ARP56220_P050-HRP Conjugated

ARP56220_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-105511 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HIST2H2BF (ARP56220_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HIST2H2BF (ARP56220_P050) antibody is Catalog # AAP56220 (Previous Catalog # AAPP38138)
Printable datasheet for anti-HIST2H2BF (ARP56220_P050) antibody
Target Reference:
Kim,S.C., (2006) Mol. Cell 23 (4), 607-618
Gene Symbol:
Official Gene Full Name:
Histone cluster 2, H2bf
Alias Symbols:
NCBI Gene Id:
Protein Name:
Histone H2B type 2-F
Description of Target:
HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIST2H2BF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIST2H2BF.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...