Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP56220_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56220_P050-FITC Conjugated

ARP56220_P050-HRP Conjugated

ARP56220_P050-Biotin Conjugated

HIST2H2BF Antibody - N-terminal region (ARP56220_P050)

Catalog#: ARP56220_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105511 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HIST2H2BF (ARP56220_P050)
Peptide Sequence Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HIST2H2BF (ARP56220_P050) antibody is Catalog # AAP56220 (Previous Catalog # AAPP38138)
Datasheets/Manuals Printable datasheet for anti-HIST2H2BF (ARP56220_P050) antibody
Target Reference Kim,S.C., (2006) Mol. Cell 23 (4), 607-618
Gene Symbol HIST2H2BF
Official Gene Full Name Histone cluster 2, H2bf
Alias Symbols MGC131639
NCBI Gene Id 440689
Protein Name Histone H2B type 2-F
Description of Target HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Swissprot Id Q5QNW6
Protein Accession # NP_001019770
Nucleotide Accession # NM_001024599
Protein Size (# AA) 126
Molecular Weight 14kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HIST2H2BF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HIST2H2BF.
Protein Interactions SPRTN; UBC; rev; IGSF8; ICAM1; CD81; ITGA4;
  1. What is the species homology for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    This target may also be called "MGC131639" in publications.

  5. What is the shipping cost for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HIST2H2BF Antibody - N-terminal region (ARP56220_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HIST2H2BF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HIST2H2BF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HIST2H2BF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HIST2H2BF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HIST2H2BF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HIST2H2BF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HIST2H2BF Antibody - N-terminal region (ARP56220_P050)
Your Rating