- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-HIST2H2AA4 (ARP79953_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2AA3 |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HIST2H2AA4 (ARP79953_P050) antibody is Catalog # AAP79953 |
| Gene Symbol | HIST2H2AA4 |
|---|---|
| Gene Full Name | histone cluster 2 H2A family member a4 |
| Alias Symbols | H2A/R, H2AC18, HIST2H2AA4 |
| NCBI Gene Id | 723790 |
| Protein Name | histone H2A type 2-A |
| Description of Target | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the telomeric copy. |
| Uniprot ID | Q6FI13 |
| Protein Accession # | NP_001035807.1 |
| Nucleotide Accession # | NM_001040874.1 |
| Protein Size (# AA) | 130 |
| Molecular Weight | 14 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
This target may also be called "H2A/R, H2AC18, HIST2H2AA4" in publications.
-
What is the shipping cost for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "14 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HIST2H2AA4 Antibody - N-terminal region (ARP79953_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HIST2H2AA4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HIST2H2AA4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HIST2H2AA4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HIST2H2AA4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HIST2H2AA4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HIST2H2AA4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
