Size:100 ul
$319.00
In stock
SKU
ARP32586_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32586_P050-FITC Conjugated

ARP32586_P050-HRP Conjugated

ARP32586_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100383 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data Anti-HIPK2 (ARP32586_P050)
Peptide Sequence Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HIPK2 (ARP32586_P050) antibody is Catalog # AAP32586
Datasheets/Manuals Printable datasheet for anti-HIPK2 (ARP32586_P050) antibody
Sample Type Confirmation

HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2

Publications

Choi, D. W. et al. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1. J. Biol. Chem. 283, 4682-9 (2008). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18093972

Steinmann, S. et al. v-Myc inhibits C/EBPbeta activity by preventing C/EBPbeta-induced phosphorylation of the co-activator p300. Oncogene 28, 2446-55 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19448669

Upadhyay, M; Bhadauriya, P; Ganesh, S; Heat shock modulates the subcellular localization, stability, and activity of HIPK2. 472, 580-4 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26972256

Gene Symbol HIPK2
Official Gene Full Name Homeodomain interacting protein kinase 2
Alias Symbols DKFZp686K02111, FLJ23711, PRO0593
NCBI Gene Id 28996
Protein Name Homeodomain-interacting protein kinase 2
Description of Target HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
Swissprot Id Q9H2X6
Protein Accession # NP_073577
Nucleotide Accession # NM_022740
Protein Size (# AA) 1198
Molecular Weight 120kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HIPK2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HIPK2.
Protein Interactions UBC; TP53; SIAH2; XAF1; AATF; SUMO1; MDM2; AXIN1; SIAH1; MBP; DAXX; MKNK1; MECP2; ZBTB4; HIPK2; DCAF7; DYRK1B; MAP3K1; DYRK1A; FBXO3; CBX4; SUMO2; SUMO3; PML; PAX6; CHMP4B; SENP2; SENP1; UBE2I; HIST2H2BE; CXCL1; SIAH1P1; WSB1; MYBL2; MYBL1; NLK; MAP3K7; M
Write Your Own Review
You're reviewing:HIPK2 Antibody - middle region (ARP32586_P050)
Your Rating