Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HIPK2 Antibody - middle region (ARP32586_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32586_P050-FITC Conjugated

ARP32586_P050-HRP Conjugated

ARP32586_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Homeodomain interacting protein kinase 2
NCBI Gene Id:
Protein Name:
Homeodomain-interacting protein kinase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp686K02111, FLJ23711, PRO0593
Replacement Item:
This antibody may replace item sc-100383 from Santa Cruz Biotechnology.
Description of Target:
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIPK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIPK2.
The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data:
Anti-HIPK2 (ARP32586_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HIPK2 (ARP32586_P050) antibody is Catalog # AAP32586
Printable datasheet for anti-HIPK2 (ARP32586_P050) antibody
Sample Type Confirmation:

HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2


Choi, D. W. et al. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1. J. Biol. Chem. 283, 4682-9 (2008). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18093972

Steinmann, S. et al. v-Myc inhibits C/EBPbeta activity by preventing C/EBPbeta-induced phosphorylation of the co-activator p300. Oncogene 28, 2446-55 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19448669

Upadhyay, M; Bhadauriya, P; Ganesh, S; Heat shock modulates the subcellular localization, stability, and activity of HIPK2. 472, 580-4 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26972256

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...