Size:100 ul
$319.00
In Stock
SKU
ARP32586_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32586_P050-FITC Conjugated

ARP32586_P050-HRP Conjugated

ARP32586_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100383 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data Anti-HIPK2 (ARP32586_P050)
Peptide Sequence Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HIPK2 (ARP32586_P050) antibody is Catalog # AAP32586
Datasheets/Manuals Printable datasheet for anti-HIPK2 (ARP32586_P050) antibody
Sample Type Confirmation

HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2

Publications

Choi, D. W. et al. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1. J. Biol. Chem. 283, 4682-9 (2008). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18093972

Steinmann, S. et al. v-Myc inhibits C/EBPbeta activity by preventing C/EBPbeta-induced phosphorylation of the co-activator p300. Oncogene 28, 2446-55 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19448669

Upadhyay, M; Bhadauriya, P; Ganesh, S; Heat shock modulates the subcellular localization, stability, and activity of HIPK2. 472, 580-4 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26972256

Gene Symbol HIPK2
Official Gene Full Name Homeodomain interacting protein kinase 2
Alias Symbols DKFZp686K02111, FLJ23711, PRO0593
NCBI Gene Id 28996
Protein Name Homeodomain-interacting protein kinase 2
Description of Target HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
Swissprot Id Q9H2X6
Protein Accession # NP_073577
Nucleotide Accession # NM_022740
Protein Size (# AA) 1198
Molecular Weight 120kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HIPK2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HIPK2.
Protein Interactions UBC; TP53; SIAH2; XAF1; AATF; SUMO1; MDM2; AXIN1; SIAH1; MBP; DAXX; MKNK1; MECP2; ZBTB4; HIPK2; DCAF7; DYRK1B; MAP3K1; DYRK1A; FBXO3; CBX4; SUMO2; SUMO3; PML; PAX6; CHMP4B; SENP2; SENP1; UBE2I; HIST2H2BE; CXCL1; SIAH1P1; WSB1; MYBL2; MYBL1; NLK; MAP3K7; M
  1. What is the species homology for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "HIPK2 Antibody - middle region (ARP32586_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HIPK2 Antibody - middle region (ARP32586_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    This target may also be called "DKFZp686K02111, FLJ23711, PRO0593" in publications.

  5. What is the shipping cost for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "120kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HIPK2 Antibody - middle region (ARP32586_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HIPK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HIPK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HIPK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HIPK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HIPK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HIPK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HIPK2 Antibody - middle region (ARP32586_P050)
Your Rating
We found other products you might like!