Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HIPK2 Antibody - middle region (ARP32586_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP32586_P050-FITC Conjugated

ARP32586_P050-HRP Conjugated

ARP32586_P050-Biotin Conjugated

Gene Symbol:
HIPK2
NCBI Gene Id:
28996
Official Gene Full Name:
Homeodomain interacting protein kinase 2
Protein Name:
Homeodomain-interacting protein kinase 2
Swissprot Id:
Q9H2X6
Protein Accession #:
NP_073577
Nucleotide Accession #:
NM_022740
Alias Symbols:
DKFZp686K02111, FLJ23711, PRO0593
Replacement Item:
This antibody may replace item sc-100383 from Santa Cruz Biotechnology.
Description of Target:
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
Protein Size (# AA):
1198
Molecular Weight:
120kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIPK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIPK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data:
Anti-HIPK2 (ARP32586_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TP53; SIAH2; XAF1; AATF; SUMO1; MDM2; AXIN1; SIAH1; MBP; DAXX; MKNK1; MECP2; ZBTB4; HIPK2; DCAF7; DYRK1B; MAP3K1; DYRK1A; FBXO3; CBX4; SUMO2; SUMO3; PML; PAX6; CHMP4B; SENP2; SENP1; UBE2I; HIST2H2BE; CXCL1; SIAH1P1; WSB1; MYBL2; MYBL1; NLK; MAP3K7; M
Blocking Peptide:
For anti-HIPK2 (ARP32586_P050) antibody is Catalog # AAP32586
Datasheets/Manuals:
Printable datasheet for anti-HIPK2 (ARP32586_P050) antibody
Sample Type Confirmation:

HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2

Publications:

Choi, D. W. et al. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1. J. Biol. Chem. 283, 4682-9 (2008). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18093972

Steinmann, S. et al. v-Myc inhibits C/EBPbeta activity by preventing C/EBPbeta-induced phosphorylation of the co-activator p300. Oncogene 28, 2446-55 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19448669

Upadhyay, M; Bhadauriya, P; Ganesh, S; Heat shock modulates the subcellular localization, stability, and activity of HIPK2. 472, 580-4 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26972256

Tell us what you think about this item!

Write A Review
    Please, wait...