Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HINT1 antibody - N-terminal region (ARP54766_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP54766_P050-FITC Conjugated

ARP54766_P050-HRP Conjugated

ARP54766_P050-Biotin Conjugated

Gene Symbol:
HINT1
NCBI Gene Id:
3094
Official Gene Full Name:
Histidine triad nucleotide binding protein 1
Protein Name:
Histidine triad nucleotide-binding protein 1
Swissprot Id:
P49773
Protein Accession #:
NP_005331
Nucleotide Accession #:
NM_005340
Alias Symbols:
FLJ30414, FLJ32340, HINT, PKCI-1, PRKCNH1
Replacement Item:
This antibody may replace item sc-107592 from Santa Cruz Biotechnology.
Description of Target:
HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
Protein Size (# AA):
126
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HINT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HINT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-HINT1 (ARP54766_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CDC16; LEF1; RUVBL2; RUVBL1; CTNNB1; DHX36; RBX1; SP1; CDC34; MITF; SIN3A; HDAC9; KAT5; HINT1; TRIM29;
Blocking Peptide:
For anti-HINT1 (ARP54766_P050) antibody is Catalog # AAP54766 (Previous Catalog # AAPP31561)
Datasheets/Manuals:
Printable datasheet for anti-HINT1 (ARP54766_P050) antibody
Sample Type Confirmation:

HINT1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Additional Information:
IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 2.5 ug/ml.
Target Reference:
Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079

Tell us what you think about this item!

Write A Review
    Please, wait...