- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-HGF (ARP44317_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HGF |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 80% |
Peptide Sequence | Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HGF (ARP44317_P050-FITC) antibody is Catalog # AAP44317 (Previous Catalog # AAPP25695) |
Sample Type Confirmation | There is BioGPS gene expression data showing that HGF is expressed in HEK293T |
Specificity | 100% homologous to all 6 isoforms; 1 (83kDa), 2 (34kDa), 3 (83kDa), 4 (35kDa), 5 (33kDa), 6 (24kDa) |
Reference | Kitajima,Y., (2008) Cancer Sci. 99 (7), 1341-1347 |
Publications | Ji, R. et al. The differentiation of MSCs into functional hepatocyte-like cells in a liver biomatrix scaffold and their transplantation into liver-fibrotic mice. Biomaterials 33, 8995-9008 (2012). WB, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 22985996 Sen, B., Peng, S., Saigal, B., Williams, M. D. & Johnson, F. M. Distinct interactions between c-Src and c-Met in mediating resistance to c-Src inhibition in head and neck cancer. Clin. Cancer Res. 17, 514-24 (2011). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21106725 Williams, C. M. et al. Autocrine-controlled formation and function of tissue-like aggregates by primary hepatocytes in micropatterned hydrogel arrays. Tissue Eng. Part A 17, 1055-68 (2011). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21121876 Zampell, J. C. et al. Lymphatic function is regulated by a coordinated expression of lymphangiogenic and anti-lymphangiogenic cytokines. Am. J. Physiol. Cell Physiol. 302, C392-404 (2012). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21940662 Nejak-Bowen, K., Orr, A., Bowen, W. C. & Michalopoulos, G. K. Conditional genetic elimination of hepatocyte growth factor in mice compromises liver regeneration after partial hepatectomy. PLoS One 8, e59836 (2013). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 23527275 |
Gene Symbol | HGF |
---|---|
Gene Full Name | Hepatocyte growth factor (hepapoietin A; scatter factor) |
Alias Symbols | SF, HGFB, HPTA, F-TCF, DFNB39 |
NCBI Gene Id | 3082 |
Protein Name | Hepatocyte growth factor |
Description of Target | Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. |
Uniprot ID | P14210 |
Protein Accession # | NP_001010932 |
Nucleotide Accession # | NM_001010932 |
Protein Size (# AA) | 728 |
Molecular Weight | 83kDa |
Protein Interactions | ADAMTSL4; MEOX2; MET; F11; ST14; HGFAC; LCN2; KLKB1; VTN; PLAU; CLEC3B; SDC1; SDC2; HPN; HGF; FN1; NRP1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
This target may also be called "SF, HGFB, HPTA, F-TCF, DFNB39" in publications.
-
What is the shipping cost for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "83kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HGF Antibody - N-terminal region : FITC (ARP44317_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HGF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HGF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HGF"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HGF"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HGF"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HGF"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.