Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP44317_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP44317_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-HGF (ARP44317_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HGF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 80%
Peptide SequenceSynthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
Concentration0.5 mg/ml
Blocking PeptideFor anti-HGF (ARP44317_P050-Biotin) antibody is Catalog # AAP44317 (Previous Catalog # AAPP25695)
Sample Type Confirmation

There is BioGPS gene expression data showing that HGF is expressed in HEK293T

Specificity100% homologous to all 6 isoforms; 1 (83kDa), 2 (34kDa), 3 (83kDa), 4 (35kDa), 5 (33kDa), 6 (24kDa)
ReferenceKitajima,Y., (2008) Cancer Sci. 99 (7), 1341-1347
Publications

Ji, R. et al. The differentiation of MSCs into functional hepatocyte-like cells in a liver biomatrix scaffold and their transplantation into liver-fibrotic mice. Biomaterials 33, 8995-9008 (2012). WB, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 22985996

Sen, B., Peng, S., Saigal, B., Williams, M. D. & Johnson, F. M. Distinct interactions between c-Src and c-Met in mediating resistance to c-Src inhibition in head and neck cancer. Clin. Cancer Res. 17, 514-24 (2011). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21106725

Williams, C. M. et al. Autocrine-controlled formation and function of tissue-like aggregates by primary hepatocytes in micropatterned hydrogel arrays. Tissue Eng. Part A 17, 1055-68 (2011). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21121876

Zampell, J. C. et al. Lymphatic function is regulated by a coordinated expression of lymphangiogenic and anti-lymphangiogenic cytokines. Am. J. Physiol. Cell Physiol. 302, C392-404 (2012). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 21940662

Nejak-Bowen, K., Orr, A., Bowen, W. C. & Michalopoulos, G. K. Conditional genetic elimination of hepatocyte growth factor in mice compromises liver regeneration after partial hepatectomy. PLoS One 8, e59836 (2013). WB, IHC, ICC/IF, Human, Rabbit, Bovine, Pig, Horse, Rat, Mouse, Dog, Sheep, Guinea pig, Zebrafish 23527275

Gene SymbolHGF
Gene Full NameHepatocyte growth factor (hepapoietin A; scatter factor)
Alias SymbolsSF, HGFB, HPTA, F-TCF, DFNB39
NCBI Gene Id3082
Protein NameHepatocyte growth factor
Description of TargetHepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms.
Uniprot IDP14210
Protein Accession #NP_001010932
Nucleotide Accession #NM_001010932
Protein Size (# AA)728
Molecular Weight83kDa
Protein InteractionsADAMTSL4; MEOX2; MET; F11; ST14; HGFAC; LCN2; KLKB1; VTN; PLAU; CLEC3B; SDC1; SDC2; HPN; HGF; FN1; NRP1;
  1. What is the species homology for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    This target may also be called "SF, HGFB, HPTA, F-TCF, DFNB39" in publications.

  5. What is the shipping cost for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HGF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HGF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HGF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HGF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HGF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HGF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HGF Antibody - N-terminal region : Biotin (ARP44317_P050-Biotin)
Your Rating
We found other products you might like!