Size:100 ul
$319.00
In stock
SKU
ARP44317_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44317_P050-FITC Conjugated

ARP44317_P050-HRP Conjugated

ARP44317_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13087 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HGF
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-HGF (ARP44317_P050)
Peptide Sequence Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HGF (ARP44317_P050) antibody is Catalog # AAP44317 (Previous Catalog # AAPP25695)
Datasheets/Manuals Printable datasheet for anti-HGF (ARP44317_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that HGF is expressed in HEK293T

Specificity 100% homologous to all 6 isoforms; 1 (83kDa), 2 (34kDa), 3 (83kDa), 4 (35kDa), 5 (33kDa), 6 (24kDa)
Target Reference Kitajima,Y., (2008) Cancer Sci. 99 (7), 1341-1347
Publications

Ji, R. et al. The differentiation of MSCs into functional hepatocyte-like cells in a liver biomatrix scaffold and their transplantation into liver-fibrotic mice. Biomaterials 33, 8995-9008 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 22985996

Nejak-Bowen, K., Orr, A., Bowen, W. C. & Michalopoulos, G. K. Conditional genetic elimination of hepatocyte growth factor in mice compromises liver regeneration after partial hepatectomy. PLoS One 8, e59836 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 23527275

Sen, B., Peng, S., Saigal, B., Williams, M. D. & Johnson, F. M. Distinct interactions between c-Src and c-Met in mediating resistance to c-Src inhibition in head and neck cancer. Clin. Cancer Res. 17, 514-24 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 21106725

Williams, C. M. et al. Autocrine-controlled formation and function of tissue-like aggregates by primary hepatocytes in micropatterned hydrogel arrays. Tissue Eng. Part A 17, 1055-68 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 21121876

Zampell, J. C. et al. Lymphatic function is regulated by a coordinated expression of lymphangiogenic and anti-lymphangiogenic cytokines. Am. J. Physiol. Cell Physiol. 302, C392-404 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 21940662

Gene Symbol HGF
Official Gene Full Name Hepatocyte growth factor (hepapoietin A; scatter factor)
Alias Symbols F-TCF, HGFB, HPTA, SF, DFNB39
NCBI Gene Id 3082
Protein Name Hepatocyte growth factor
Description of Target Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms.
Swissprot Id P14210
Protein Accession # NP_001010932
Nucleotide Accession # NM_001010932
Protein Size (# AA) 728
Molecular Weight 83kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HGF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HGF.
Protein Interactions ADAMTSL4; MEOX2; MET; F11; ST14; HGFAC; LCN2; KLKB1; VTN; PLAU; CLEC3B; SDC1; SDC2; HPN; HGF; FN1; NRP1;
Write Your Own Review
You're reviewing:HGF Antibody - N-terminal region (ARP44317_P050)
Your Rating