Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP31866_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31866_T100-FITC Conjugated

ARP31866_T100-HRP Conjugated

ARP31866_T100-Biotin Conjugated

HEYL Antibody - N-terminal region (ARP31866_T100)

Catalog#: ARP31866_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-16448 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HEYL
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology dataAnti-HEYL (ARP31866_T100)
Peptide SequenceSynthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HEYL (ARP31866_T100) antibody is Catalog # AAP31866 (Previous Catalog # AAPP02661)
Datasheets/ManualsPrintable datasheet for anti-HEYL (ARP31866_T100) antibody
Target ReferenceNakagawa,O., et al., (2000) McFadden,D.G., Nakagawa,M., Proc. Natl. Acad. Sci. U.S.A. 97 (25), 13655-13660
Publications

Morrow, D. et al. Sonic Hedgehog induces Notch target gene expression in vascular smooth muscle cells via VEGF-A. Arterioscler. Thromb. Vasc. Biol. 29, 1112-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19407245

Gene SymbolHEYL
Official Gene Full NameHairy/enhancer-of-split related with YRPW motif-like
Alias SymbolsHEY3, HRT3, bHLHb33
NCBI Gene Id26508
Protein NameHairy/enhancer-of-split related with YRPW motif-like protein
Description of TargetHEYL belongs to hairy-related bHLH transcription factor family. HEY genes are candidates for several human or mouse disease loci.
Swissprot IdQ9NQ87
Protein Accession #NP_055386
Nucleotide Accession #NM_014571
Protein Size (# AA)328
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HEYL.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HEYL.
Protein InteractionsRPGRIP1; RBPMS; MDFI; ZNF512B; HIPK3; LAPTM5; SKIL; ATXN1; PPP1CA; SMAD9; SMAD7; SMAD3; HTT; APP; UBC; SP8; ATF7IP; HAND2; HAND1;
  1. What is the species homology for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HEYL Antibody - N-terminal region (ARP31866_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    This target may also be called "HEY3, HRT3, bHLHb33" in publications.

  5. What is the shipping cost for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HEYL Antibody - N-terminal region (ARP31866_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HEYL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HEYL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HEYL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HEYL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HEYL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HEYL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HEYL Antibody - N-terminal region (ARP31866_T100)
Your Rating
Aviva Pathways
Aviva Tissue Tool
Aviva Blast Tool
Free Microscope