Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HEYL antibody - N-terminal region (ARP31866_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP31866_T100-FITC Conjugated

ARP31866_T100-HRP Conjugated

ARP31866_T100-Biotin Conjugated

Gene Symbol:
HEYL
NCBI Gene Id:
26508
Official Gene Full Name:
Hairy/enhancer-of-split related with YRPW motif-like
Protein Name:
Hairy/enhancer-of-split related with YRPW motif-like protein
Swissprot Id:
Q9NQ87
Protein Accession #:
NP_055386
Nucleotide Accession #:
NM_014571
Alias Symbols:
HEY3, HRT3, bHLHb33
Replacement Item:
This antibody may replace item sc-16448 from Santa Cruz Biotechnology.
Description of Target:
HEYL belongs to hairy-related bHLH transcription factor family. HEY genes are candidates for several human or mouse disease loci.
Protein Size (# AA):
328
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HEYL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HEYL.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HEYL
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-HEYL (ARP31866_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPGRIP1; RBPMS; MDFI; ZNF512B; HIPK3; LAPTM5; SKIL; ATXN1; PPP1CA; SMAD9; SMAD7; SMAD3; HTT; APP; UBC; SP8; ATF7IP; HAND2; HAND1;
Blocking Peptide:
For anti-HEYL (ARP31866_T100) antibody is Catalog # AAP31866 (Previous Catalog # AAPP02661)
Datasheets/Manuals:
Printable datasheet for anti-HEYL (ARP31866_T100) antibody
Target Reference:
Nakagawa,O., et al., (2000) McFadden,D.G., Nakagawa,M., Proc. Natl. Acad. Sci. U.S.A. 97 (25), 13655-13660
Publications:

Morrow, D. et al. Sonic Hedgehog induces Notch target gene expression in vascular smooth muscle cells via VEGF-A. Arterioscler. Thromb. Vasc. Biol. 29, 1112-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19407245

Tell us what you think about this item!

Write A Review
    Please, wait...