Search Antibody, Protein, and ELISA Kit Solutions

HEY1 Antibody - C-terminal region (ARP74558_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74558_P050-FITC Conjugated

ARP74558_P050-HRP Conjugated

ARP74558_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
HEY1
NCBI Gene Id:
23462
Swissprot Id:
Q9Y5J3
Protein Accession #:
NP_036390
Alias Symbols:
HEY1, BHLHB31, CHF2, HERP2, HESR1, HRT1,
Description of Target:
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
304
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HEY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HEY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HEY1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SYVN1; DERL2; HEY2; SEL1L; PRKD2; LAPTM5; SKIL; SMAD9; SMAD3; ARNT; NOTCH1; ELAVL1; FBXW7; HEY1; GATA1; MYOD1;
Blocking Peptide:
For anti-HEY1 (ARP74558_P050) antibody is Catalog # AAP74558
Datasheets/Manuals:
Printable datasheet for anti-HEY1 (ARP74558_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...