Search Antibody, Protein, and ELISA Kit Solutions

HERC5 Antibody - middle region (ARP43213_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43213_P050-FITC Conjugated

ARP43213_P050-HRP Conjugated

ARP43213_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Horse, Human, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-55837 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human HERC5
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-HERC5 (ARP43213_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HERC5 (ARP43213_P050) antibody is Catalog # AAP43213 (Previous Catalog # AAPP25182)
Printable datasheet for anti-HERC5 (ARP43213_P050) antibody
Sample Type Confirmation:

HERC5 is supported by BioGPS gene expression data to be expressed in HEK293

Target Reference:
Salon,C., (2007) Oncogene 26 (48), 6927-6936
Gene Symbol:
Official Gene Full Name:
HECT and RLD domain containing E3 ubiquitin protein ligase 5
Alias Symbols:
NCBI Gene Id:
Protein Name:
E3 ISG15--protein ligase HERC5
Description of Target:
HERC5 is a member of the HERC family of ubiquitin ligases.It contains a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulates expression of HERC5 protein in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HERC5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HERC5.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...