- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HER4 Antibody (Phospho-Tyr1284) (OAAF07575) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Additional Information | Modification Sites: Human:Y1284 Mouse:Y1268 Rat:Y1284 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human HER4 around the phosphorylation site of Tyr1284. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: RSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPP |
Concentration | 1mg/ml |
Specificity | HER4 (Phospho-Tyr1284) Antibody detects endogenous levels of HER4 only when phosphorylated at Tyr1284. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:10000 |
Gene Symbol | ERBB4 |
---|---|
Gene Full Name | erb-b2 receptor tyrosine kinase 4 |
Alias Symbols | ALS19;avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4;HER4;human epidermal growth factor receptor 4;p180erbB4;proto-oncogene-like protein c-ErbB-4;receptor tyrosine-protein kinase erbB-4;tyrosine kinase-type cell surface receptor HER4;v-erb-a erythroblastic leukemia viral oncogene homolog 4;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4. |
NCBI Gene Id | 2066 |
Protein Name | Receptor tyrosine-protein kinase erbB-4 |
Description of Target | Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation, differentiation, migration and apoptosis. Required for normal cardiac muscle differentiation during embryonic development, and for postnatal cardiomyocyte proliferation. Required for normal development of the embryonic central nervous system, especially for normal neural crest cell migration and normal axon guidance. Required for mammary gland differentiation, induction of milk proteins and lactation. Acts as cell-surface receptor for the neuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family members BTC, EREG and HBEGF. Ligand binding triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Ligand specificity and signaling is modulated by alternative splicing, proteolytic processing, and by the formation of heterodimers with other ERBB family members, thereby creating multiple combinations of intracellular phosphotyrosines that trigger ligand- and context-specific cellular responses. Mediates phosphorylation of SHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1, leading to the activation of phosphatidylinositol 3-kinase and AKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 and isoform JM-B CYT-1 mediate reorganization of the actin cytoskeleton and promote cell migration in response to NRG1. Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosine that mediates interaction with PIK3R1, and hence do not phosphorylate PIK3R1, do not protect cells against apoptosis, and do not promote reorganization of the actin cytoskeleton and cell migration. Proteolytic processing of isoform JM-A CYT-1 and isoform JM-A CYT-2 gives rise to the corresponding soluble intracellular domains (4ICD) that translocate to the nucleus, promote nuclear import of STAT5A, activation of STAT5A, mammary epithelium differentiation, cell proliferation and activation of gene expression. The ERBB4 soluble intracellular domains (4ICD) colocalize with STAT5A at the CSN2 promoter to regulate transcription of milk proteins during lactation. The ERBB4 soluble intracellular domains can also translocate to mitochondria and promote apoptosis. |
Uniprot ID | Q15303 |
Molecular Weight | 146 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
This target may also be called "ALS19;avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4;HER4;human epidermal growth factor receptor 4;p180erbB4;proto-oncogene-like protein c-ErbB-4;receptor tyrosine-protein kinase erbB-4;tyrosine kinase-type cell surface receptor HER4;v-erb-a erythroblastic leukemia viral oncogene homolog 4;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4." in publications.
-
What is the shipping cost for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "146 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ERBB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ERBB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ERBB4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ERBB4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ERBB4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ERBB4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.