- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for OAAF07575 |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC, IF |
| Additional Information | Modification Sites: Human:Y1284 Mouse:Y1268 Rat:Y1284 |
| Reconstitution and Storage | Stable at -20C for at least 1 year. |
| Immunogen | The antiserum was produced against synthesized peptide derived from human HER4 around the phosphorylation site of Tyr1284. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: RSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPP |
| Concentration | 1mg/ml |
| Specificity | HER4 (Phospho-Tyr1284) Antibody detects endogenous levels of HER4 only when phosphorylated at Tyr1284. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:10000 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
This item is available "Domestic: within 1 week delivery | International: 1 week".
-
What buffer format is "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
This target may also be called "HER4, ALS19, p180erbB4" in publications.
-
What is the shipping cost for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "146 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HER4 Antibody (Phospho-Tyr1284) (OAAF07575)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ERBB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ERBB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ERBB4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ERBB4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ERBB4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ERBB4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
