- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HER2 Antibody (Phospho-Thr686) (OAAF07555) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence |
Additional Information | Modification Sites: Human:T686 Mouse:T687 Rat:T688 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human HER2 around the phosphorylation site of Thr686. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQA |
Concentration | 1mg/ml |
Specificity | HER2 (Phospho-Thr686) Antibody detects endogenous levels of HER2 only when phosphorylated at Thr686. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IF: 1:100~1:500 ELISA: 1:5000 |
Gene Symbol | ERBB2 |
---|---|
Gene Full Name | erb-b2 receptor tyrosine kinase 2 |
Alias Symbols | CD340;c-erb B2/neu protein;HER2;HER-2;HER-2/neu;herstatin;human epidermal growth factor receptor 2;metastatic lymph node gene 19 protein;MLN 19;NEU;neuro/glioblastoma derived oncogene homolog;neuroblastoma/glioblastoma derived oncogene homolog;NGL;p185erbB2;proto-oncogene c-ErbB-2;proto-oncogene Neu;receptor tyrosine-protein kinase erbB-2;TKR1;tyrosine kinase-type cell surface receptor HER2;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2;v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2;v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog;VSCN2. |
NCBI Gene Id | 2064 |
Protein Name | Receptor tyrosine-protein kinase erbB-2 |
Description of Target | Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization. |
Uniprot ID | P04626 |
Molecular Weight | 137 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "HER2 Antibody (Phospho-Thr686) (OAAF07555)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
This target may also be called "CD340;c-erb B2/neu protein;HER2;HER-2;HER-2/neu;herstatin;human epidermal growth factor receptor 2;metastatic lymph node gene 19 protein;MLN 19;NEU;neuro/glioblastoma derived oncogene homolog;neuroblastoma/glioblastoma derived oncogene homolog;NGL;p185erbB2;proto-oncogene c-ErbB-2;proto-oncogene Neu;receptor tyrosine-protein kinase erbB-2;TKR1;tyrosine kinase-type cell surface receptor HER2;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2;v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2;v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog;VSCN2." in publications.
-
What is the shipping cost for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "137 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HER2 Antibody (Phospho-Thr686) (OAAF07555)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ERBB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ERBB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ERBB2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ERBB2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ERBB2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ERBB2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.