Search Antibody, Protein, and ELISA Kit Solutions

Helt Antibody - C-terminal region (ARP37537_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37537_P050-FITC Conjugated

ARP37537_P050-HRP Conjugated

ARP37537_P050-Biotin Conjugated

Gene Symbol:
Helt
Official Gene Full Name:
helt bHLH transcription factor
NCBI Gene Id:
234219
Protein Name:
Hairy and enhancer of split-related protein HELT
Swissprot Id:
Q7TS99
Protein Accession #:
NP_776150
Nucleotide Accession #:
NM_173789
Alias Symbols:
A830086M02, Hesl, Mgn, megane
Replacement Item:
This antibody may replace item sc-145948 from Santa Cruz Biotechnology.
Description of Target:
Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons.
Protein Size (# AA):
240
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Helt.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Helt.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Helt
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Guinea Pig: 77%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 77%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Helt; Hey2; Hes5;
Blocking Peptide:
For anti-Helt (ARP37537_P050) antibody is Catalog # AAP37537
Datasheets/Manuals:
Printable datasheet for anti-Helt (ARP37537_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...