Helt Antibody - C-terminal region (ARP37537_P050)

Catalog No: ARP37537_P050

Host: Rabbit
Target Name: Helt
Sample Type: Mouse Stomach lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Helt
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Guinea Pig: 77%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 77%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Helt (ARP37537_P050) antibody is Catalog # AAP37537

Target Info

• Gene Symbol: Helt
• Gene Full Name: helt bHLH transcription factor
• Alias Symbols: Mgn, Hesl, mega, megane, Heslike, A830086M02
• NCBI Gene Id: 234219
• Protein Name: Hairy and enhancer of split-related protein HELT
• Description of Target: Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons.
• Uniprot ID: Q7TS99
• Protein Accession #: NP_776150
• Nucleotide Accession #: NM_173789
• Protein Size (# AA): 240
• Molecular Weight: 27kDa
• Protein Interactions: Helt; Hey2; Hes5;