Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP43481_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43481_P050-FITC Conjugated

ARP43481_P050-HRP Conjugated

ARP43481_P050-Biotin Conjugated

HECTD2 Antibody - C-terminal region (ARP43481_P050)

Catalog#: ARP43481_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Complete computational species homology data Anti-HECTD2 (ARP43481_P050)
Peptide Sequence Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
Datasheets/Manuals Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody
Target Reference Deloukas,P., (2004) Nature 429 (6990), 375-381
Publications

Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene. 33, 2790-800 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851

Gene Symbol HECTD2
Official Gene Full Name HECT domain containing E3 ubiquitin protein ligase 2
Alias Symbols FLJ16050
NCBI Gene Id 143279
Protein Name Probable E3 ubiquitin-protein ligase HECTD2
Description of Target HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Swissprot Id Q5RD78
Protein Accession # NP_877497
Nucleotide Accession # NM_182765
Protein Size (# AA) 776
Molecular Weight 88kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HECTD2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
Protein Interactions ELAVL1; UBC;
Write Your Own Review
You're reviewing:HECTD2 Antibody - C-terminal region (ARP43481_P050)
Your Rating