HECTD2 Antibody - C-terminal region (ARP43481_P050)

Catalog#: ARP43481_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human Muscle

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP43481_P050-FITC Conjugated

ARP43481_P050-HRP Conjugated

ARP43481_P050-Biotin Conjugated

Gene Symbol:: HECTD2
Official Gene Full Name:: HECT domain containing E3 ubiquitin protein ligase 2
NCBI Gene Id:: 143279
Protein Name:: Probable E3 ubiquitin-protein ligase HECTD2
Swissprot Id:: Q5RD78
Protein Accession #:: NP_877497
Nucleotide Accession #:: NM_182765
Alias Symbols:: FLJ16050
Replacement Item:: This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
Description of Target:: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Protein Size (# AA):: 776
Molecular Weight:: 88kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express HECTD2.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
Immunogen:: The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Complete computational species homology data:: Anti-HECTD2 (ARP43481_P050)
Peptide Sequence:: Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: ELAVL1; UBC;
Blocking Peptide:: For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
Datasheets/Manuals:: Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody

Target Reference:: Deloukas,P., (2004) Nature 429 (6990), 375-381
Publications:: Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene. 33, 2790-800 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851