HECTD2 Antibody - C-terminal region (ARP43481_P050)

Size:100 ul

Human Muscle

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
• Complete computational species homology data: Anti-HECTD2 (ARP43481_P050)
• Peptide Sequence: Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
• Datasheets/Manuals: Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody
• Target Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381
• Publications:

  Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene. 33, 2790-800 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851

Target Info

• Gene Symbol: HECTD2
• Official Gene Full Name: HECT domain containing E3 ubiquitin protein ligase 2
• Alias Symbols: FLJ16050
• NCBI Gene Id: 143279
• Protein Name: Probable E3 ubiquitin-protein ligase HECTD2
• Description of Target: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
• Swissprot Id: Q5RD78
• Protein Accession #: NP_877497
• Nucleotide Accession #: NM_182765
• Protein Size (# AA): 776
• Molecular Weight: 88kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express HECTD2.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
• Protein Interactions: ELAVL1; UBC;