HECTD2 Antibody - C-terminal region (ARP43481_P050)

Catalog#: ARP43481_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: HECTD2
• Official Gene Full Name: HECT domain containing E3 ubiquitin protein ligase 2
• NCBI Gene Id: 143279
• Protein Name: Probable E3 ubiquitin-protein ligase HECTD2
• Swissprot Id: Q5RD78
• Protein Accession #: NP_877497
• Nucleotide Accession #: NM_182765
• Alias Symbols: FLJ16050
• Replacement Item: This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
• Description of Target: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
• Protein Size (# AA): 776
• Molecular Weight: 88kDa
• Purification: Affinity Purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: ELAVL1; UBC;
• Blocking Peptide: For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
• Target Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381
• Publications:

  Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene. 33, 2790-800 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: HECTD2 antibody tested with Human Fetal Muscle Tissue (ARP43481_P050)