- Gene Symbol:
- HECTD2
- NCBI Gene Id:
- 143279
- Official Gene Full Name:
- HECT domain containing E3 ubiquitin protein ligase 2
- Protein Name:
- Probable E3 ubiquitin-protein ligase HECTD2
- Swissprot Id:
- Q5RD78
- Protein Accession #:
- NP_877497
- Nucleotide Accession #:
- NM_182765
- Alias Symbols:
- FLJ16050
- Replacement Item:
- This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
- Description of Target:
- HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
- Protein Size (# AA):
- 776
- Molecular Weight:
- 88kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express HECTD2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
- Complete computational species homology data:
- Anti-HECTD2 (ARP43481_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- ELAVL1; UBC;
- Blocking Peptide:
- For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
- Datasheets/Manuals:
- Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody
- Target Reference:
- Deloukas,P., (2004) Nature 429 (6990), 375-381
- Publications:
Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene (2013). doi:10.1038/onc.2013.230 WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
