Search Antibody, Protein, and ELISA Kit Solutions

HECTD2 antibody - C-terminal region (ARP43481_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43481_P050-FITC Conjugated

ARP43481_P050-HRP Conjugated

ARP43481_P050-Biotin Conjugated

Gene Symbol:
HECTD2
NCBI Gene Id:
143279
Official Gene Full Name:
HECT domain containing E3 ubiquitin protein ligase 2
Protein Name:
Probable E3 ubiquitin-protein ligase HECTD2
Swissprot Id:
Q5RD78
Protein Accession #:
NP_877497
Nucleotide Accession #:
NM_182765
Alias Symbols:
FLJ16050
Replacement Item:
This antibody may replace item sc-145929 from Santa Cruz Biotechnology.
Description of Target:
HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Protein Size (# AA):
776
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HECTD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HECTD2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Complete computational species homology data:
Anti-HECTD2 (ARP43481_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1; UBC;
Blocking Peptide:
For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342)
Datasheets/Manuals:
Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody
Target Reference:
Deloukas,P., (2004) Nature 429 (6990), 375-381
Publications:

Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene (2013). doi:10.1038/onc.2013.230 WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23770851

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...