Search Antibody, Protein, and ELISA Kit Solutions

HDGF Antibody - middle region (ARP84389_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
hepatoma-derived growth factor
NCBI Gene Id:
Protein Name:
hepatoma-derived growth factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
Molecular Weight:
25 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDGF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDGF.
The immunogen is a synthetic peptide directed towards the middle region of human HDGF
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HDGF (ARP84389_P050) antibody is Catalog # AAP84389
Printable datasheet for anti-HDGF (ARP84389_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...