Size:100 ul
$249.00
In Stock
SKU
ARP42788_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42788_T100-FITC Conjugated

ARP42788_T100-HRP Conjugated

ARP42788_T100-Biotin Conjugated

HDAC9 Antibody - C-terminal region (ARP42788_T100)

Catalog#: ARP42788_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human, Mouse, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10408 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%
Complete computational species homology data Anti-HDAC9 (ARP42788_T100)
Peptide Sequence Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HDAC9 (ARP42788_T100) antibody is Catalog # AAP42788 (Previous Catalog # AAPS10202)
Datasheets/Manuals Printable datasheet for anti-HDAC9 (ARP42788_T100) antibody
Sample Type Confirmation

HDAC9 is supported by BioGPS gene expression data to be expressed in A172

Target Reference Han,A., (2005) J. Mol. Biol. 345 (1), 91-102
Publications

Hang, C. T. et al. Chromatin regulation by Brg1 underlies heart muscle development and disease. Nature 466, 62-7 (2010). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 20596014

Milde, T. et al. HDAC5 and HDAC9 in medulloblastoma: novel markers for risk stratification and role in tumor cell growth. Clin. Cancer Res. 16, 3240-52 (2010). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 20413433

Spallotta, F. et al. Detrimental effect of class-selective histone deacetylase inhibitors during tissue regeneration following hindlimb ischemia. J. Biol. Chem. 288, 22915-29 (2013). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 23836913

Gene Symbol HDAC9
Official Gene Full Name Histone deacetylase 9
Alias Symbols DKFZp779K1053, HD7, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, KIAA0744, MITR, HD9, HD7b
NCBI Gene Id 9734
Protein Name Histone deacetylase 9
Description of Target Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.
Swissprot Id Q9UKV0-3, Q9UKV0-8, Q9UKV0-9, Q9UKV0-10, Q9UKV0-11
Protein Accession # NP_055522
Nucleotide Accession # NM_014707
Protein Size (# AA) 590
Molecular Weight 65kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HDAC9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HDAC9.
Protein Interactions NOP2; MKI67; EIF6; RCC1; ADAR; TOP1; TMPO; FIP1L1; CCAR2; TPX2; RBM14; ZC3H11A; HDAC9; NUP93; SMC3; H1FX; TPR; HINT1; CTBP1; BCL6; Zfp521; TRIM29; TP53; MAML1; SMARCA4; PARP1; CEBPB; H3F3A; RL2; CAMK1; YWHAE; HDAC1; SFN; MEF2B; ANKRA2; RFXANK; PKD1; SYK;
  1. What is the species homology for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse, Sheep".

  2. How long will it take to receive "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HDAC9 Antibody - C-terminal region (ARP42788_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    This target may also be called "DKFZp779K1053, HD7, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, KIAA0744, MITR, HD9, HD7b" in publications.

  5. What is the shipping cost for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HDAC9 Antibody - C-terminal region (ARP42788_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HDAC9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HDAC9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HDAC9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HDAC9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HDAC9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HDAC9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HDAC9 Antibody - C-terminal region (ARP42788_T100)
Your Rating
We found other products you might like!