Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HDAC9 Antibody - C-terminal region (ARP42788_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42788_T100-FITC Conjugated

ARP42788_T100-HRP Conjugated

ARP42788_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Histone deacetylase 9
NCBI Gene Id:
Protein Name:
Histone deacetylase 9
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10408 from Santa Cruz Biotechnology.
Description of Target:
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDAC9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDAC9.
The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Sheep
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%
Complete computational species homology data:
Anti-HDAC9 (ARP42788_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HDAC9 (ARP42788_T100) antibody is Catalog # AAP42788 (Previous Catalog # AAPS10202)
Printable datasheet for anti-HDAC9 (ARP42788_T100) antibody
Sample Type Confirmation:

HDAC9 is supported by BioGPS gene expression data to be expressed in A172

Target Reference:
Han,A., (2005) J. Mol. Biol. 345 (1), 91-102

Hang, C. T. et al. Chromatin regulation by Brg1 underlies heart muscle development and disease. Nature 466, 62-7 (2010). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 20596014

Milde, T. et al. HDAC5 and HDAC9 in medulloblastoma: novel markers for risk stratification and role in tumor cell growth. Clin. Cancer Res. 16, 3240-52 (2010). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 20413433

Spallotta, F. et al. Detrimental effect of class-selective histone deacetylase inhibitors during tissue regeneration following hindlimb ischemia. J. Biol. Chem. 288, 22915-29 (2013). CHIP, IHC, WB, Guinea Pig, Human, Mouse, Sheep 23836913

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...