Search Antibody, Protein, and ELISA Kit Solutions

HDAC6 Antibody - N-terminal region (ARP31451_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31451_P050-FITC Conjugated

ARP31451_P050-HRP Conjugated

ARP31451_P050-Biotin Conjugated

Gene Symbol:
HDAC6
Official Gene Full Name:
Histone deacetylase 6
NCBI Gene Id:
10013
Protein Name:
HDAC6 protein EMBL AAH05872.1
Swissprot Id:
Q9UBN7
Protein Accession #:
AAH05872
Nucleotide Accession #:
NM_006044
Alias Symbols:
HD6, JM21
Replacement Item:
This antibody may replace item sc-11420 from Santa Cruz Biotechnology.
Description of Target:
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
Protein Size (# AA):
1215
Molecular Weight:
131kDa, 17 kD
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, CHIP, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDAC6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDAC6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-HDAC6 (ARP31451_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSP90B1; ACTB; UBC; TRIM50; MYH10; DYNC1H1; DDIT3; ELAVL1; MAPK3; MAPK1; RUNX2; TUBA1B; SUMO1; RANBP9; NEDD8; ADRB2; ATXN3; MEF2B; SQSTM1; HSP90AA1; RASSF2; SLMAP; SAV1; CTTNBP2NL; BAG3; SETD8; TUBB; HSPA8; HSPA6; HSPA5; HSPA4; HSPA2; HSPA1L; DNAJA1; ETV6
Blocking Peptide:
For anti-HDAC6 (ARP31451_P050) antibody is Catalog # AAP31451 (Previous Catalog # AAPP02213)
Datasheets/Manuals:
Printable datasheet for anti-HDAC6 (ARP31451_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T

Target Reference:
Int J Mol Med. 2003 Jul;12(1):87-93.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...