Search Antibody, Protein, and ELISA Kit Solutions

Hdac6 Antibody - C-terminal region (ARP38730_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38730_P050-FITC Conjugated

ARP38730_P050-HRP Conjugated

ARP38730_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Histone deacetylase 6
NCBI Gene Id:
Protein Name:
Histone deacetylase 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Hd6, Hdac5, Sfc6, mHDA2
Replacement Item:
This antibody may replace item sc-11420 from Santa Cruz Biotechnology.
Description of Target:
Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Hdac6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Hdac6.
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-Hdac6 (ARP38730_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Hdac11; Ubc; Hsp90ab1; Park2; TARDBP; Vcp; USP47; HDAC6; PLAA; GARS; Tuba1a; Rela; Nfkb1; Mapt;
Blocking Peptide:
For anti-Hdac6 (ARP38730_P050) antibody is Catalog # AAP38730
Printable datasheet for anti-Hdac6 (ARP38730_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...