Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP38730_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38730_P050-FITC Conjugated

ARP38730_P050-HRP Conjugated

ARP38730_P050-Biotin Conjugated

Hdac6 Antibody - C-terminal region (ARP38730_P050)

Catalog#: ARP38730_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11420 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
Complete computational species homology data Anti-Hdac6 (ARP38730_P050)
Peptide Sequence Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Hdac6 (ARP38730_P050) antibody is Catalog # AAP38730
Datasheets/Manuals Printable datasheet for anti-Hdac6 (ARP38730_P050) antibody
Gene Symbol Hdac6
Official Gene Full Name Histone deacetylase 6
Alias Symbols Hd6, Hdac5, Sfc6, mHDA2
NCBI Gene Id 15185
Protein Name Histone deacetylase 6
Description of Target Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
Swissprot Id Q9Z2V5
Protein Accession # NP_034543
Nucleotide Accession # NM_010413
Protein Size (# AA) 1149
Molecular Weight 126kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Hdac6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Hdac6.
Protein Interactions Hdac11; Ubc; Hsp90ab1; Park2; TARDBP; Vcp; USP47; HDAC6; PLAA; GARS; Tuba1a; Rela; Nfkb1; Mapt;
  1. What is the species homology for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Hdac6 Antibody - C-terminal region (ARP38730_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    This target may also be called "Hd6, Hdac5, Sfc6, mHDA2" in publications.

  5. What is the shipping cost for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "126kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Hdac6 Antibody - C-terminal region (ARP38730_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HDAC6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HDAC6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HDAC6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HDAC6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HDAC6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HDAC6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Hdac6 Antibody - C-terminal region (ARP38730_P050)
Your Rating
We found other products you might like!