Search Antibody, Protein, and ELISA Kit Solutions

HDAC3 Antibody - C-terminal region (ARP87383_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
HDAC3
Official Gene Full Name:
histone deacetylase 3
NCBI Gene Id:
8841
Protein Name:
histone deacetylase 3
Swissprot Id:
O15379
Protein Accession #:
NP_003874.2
Nucleotide Accession #:
NM_003883.3
Alias Symbols:
HD3, RPD3, RPD3-2
Description of Target:
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Protein Size (# AA):
428
Molecular Weight:
49 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDAC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDAC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HDAC3 (ARP87383_P050) antibody is Catalog # AAP87383
Datasheets/Manuals:
Printable datasheet for anti-HDAC3 (ARP87383_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...