HDAC2 Antibody - middle region (ARP88977_P050)

Catalog No: ARP88977_P050

Host: Rabbit
Target Name: HDAC2
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of mouse HDAC2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HDAC2 (ARP88977_P050) antibody is Catalog # AAP88977

Target Info

• Gene Symbol: HDAC2
• Gene Full Name: histone deacetylase 2
• Alias Symbols: YAF1, Yy1b, Yy1bp, mRPD3, D10Wsu179, D10Wsu179e
• NCBI Gene Id: 15182
• Protein Name: histone deacetylase 2
• Description of Target: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
• Uniprot ID: P70288
• Protein Accession #: NP_032255.2
• Nucleotide Accession #: NM_008229.2
• Protein Size (# AA): 488
• Molecular Weight: 53 kDa