Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HDAC10 Antibody - C-terminal region : FITC (ARP75816_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75816_P050 Unconjugated

ARP75816_P050-HRP Conjugated

ARP75816_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
HDAC10
Official Gene Full Name:
histone deacetylase 10
NCBI Gene Id:
83933
Protein Name:
histone deacetylase 10
Swissprot Id:
Q969S8
Protein Accession #:
NP_114408
Alias Symbols:
HD10
Description of Target:
The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in transcriptional regulation, cell cycle progression, and developmental events. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
669
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDAC10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDAC10.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HDA10
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SALESIQSARAAQAPHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-HDAC10 (ARP75816_P050-FITC) antibody is Catalog # AAP75816
Datasheets/Manuals:
Printable datasheet for anti-HDAC10 (ARP75816_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...