Search Antibody, Protein, and ELISA Kit Solutions

HBP1 antibody - middle region (ARP38977_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38977_P050-FITC Conjugated

ARP38977_P050-HRP Conjugated

ARP38977_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
HMG-box transcription factor 1
Protein Name:
HMG box-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-25390 from Santa Cruz Biotechnology.
Description of Target:
HBP1 is a transcriptional repressor that binds to the promoter region of target genes. This protein plays a role in the regulation of the cell cycle and of the Wnt pathway. It binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter, HBP1 is enhanced by interaction with RB1. The protein also can disrupt the interaction between DNA and TCF4.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HBP1.
The immunogen is a synthetic peptide directed towards the middle region of human HBP1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-HBP1 (ARP38977_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HBP1 (ARP38977_P050) antibody is Catalog # AAP38977 (Previous Catalog # AAPS05408)
Printable datasheet for anti-HBP1 (ARP38977_P050) antibody
Sample Type Confirmation:

HBP1 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Paulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145

Li, H., Bian, C., Liao, L., Li, J. & Zhao, R. C. miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1. Breast Cancer Res. Treat. 126, 565-75 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20505989

Wang, W., Pan, K., Chen, Y., Huang, C. & Zhang, X. The acetylation of transcription factor HBP1 by p300/CBP enhances p16INK4A expression. Nucleic Acids Res. 40, 981-95 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21967847

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...