HBB-B2 Antibody - middle region (ARP93419_P050)

Catalog No: ARP93419_P050

Host: Rabbit
Target Name: HBB-B2
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HBB-B2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HBB-B2 (ARP93419_P050) antibody is Catalog # AAP93419

Target Info

• Gene Symbol: HBB-B2
• Gene Full Name: hemoglobin, beta adult minor chain
• Alias Symbols: Hbb2, Hbbt2, beta2, AI036344
• NCBI Gene Id: 15130
• Protein Name: Hemoglobin subunit beta-2
• Description of Target: This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta-minor adult gene found in the "diffuse" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. 
• Uniprot ID: P02089
• Protein Accession #: NP_058652.1
• Nucleotide Accession #: NM_016956.3
• Protein Size (# AA): 147
• Molecular Weight: 16 kDa